Difference between revisions of "Os05g0343400"

From RiceWiki
Jump to: navigation, search
(Expression)
 
(59 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os05g0343400''''' was reported as '''''OsWRKY53''''' in 2007 <ref name="ref1" /> by researchers from Japan.  
 +
==Annotated Infomation==
 +
===Gene Symbol===
 +
*'''''Os05g0343400''''' '''''<=>''''' '''''OsWRKY53''''','''''WRKY53'''''
  
==Annotated Information==
 
 
===Function===
 
===Function===
Please input function information here.
+
* '''''WRKY''''' proteins form a large family of plant-specific transcription factors that specifically bind to the W-box elements (T)TGAC(C/T) and appear to play a regulatory role in a variety of stress responses.
 +
* '''''WRKY''''' proteins have been investigated extensively for their possible involvement in defense responses against attacks by pathogens, mainly in dicotyledonous plants such as Arabidopsis and tobacco.
 +
* The rice genome is predicted to contain over 100 WRKY (OsWRKY)genes.
 +
* '''''OsWRKY53''''' is a common transcription factor in the signal transduction pathways triggered by both chitin oligosaccharide  and fungal cerebroside elicitors.
 +
* '''''OsWRKY53'''''  is a transcription factor that plays important roles in elicitor-induced defense signaling pathways in rice.
 +
 
 +
===Phenotypic analysis===
 +
* Overexpression of '''''OsWRKY53''''' enhances resistance to rice blast fungus
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* Northern hybridization revealed a significant increase in the level of '''''WRKY53''''' mRNA at 6 h after inoculation, after which it decreased gradually
  
 +
{|class="wikitable"
 +
|+Up-regulated defense-related genes in OsWRKY53-overexpressing transgenic rice cells
 +
|-
 +
|Accession no.
 +
|Annotation 
 +
|Fold change a
 +
|Chitin oligosaccharide elicitor response b                                       
 +
|-
 +
|AK071613     
 +
|PR-10 (PBZ1)   
 +
|6.92           
 +
|  +
 +
|-
 +
|AK058896     
 +
|PR-14           
 +
|6.06           
 +
|  +
 +
|-
 +
|AK058921     
 +
|PR-14           
 +
|5.98           
 +
|  −
 +
|-
 +
|AK073267     
 +
|chitinase       
 +
|5.30           
 +
|  +
 +
|-
 +
|AK073978     
 +
|peroxidase       
 +
|4.18           
 +
| −
 +
|-
 +
|AK111104     
 +
|PR -5           
 +
|3.97           
 +
| +
 +
|-
 +
|AK102505     
 +
|chitinase       
 +
|3.67           
 +
| +
 +
|-
 +
|AK102307     
 +
|peroxidase       
 +
|3.56           
 +
|  +
 +
|-
 +
|AK063935     
 +
|cinnamoyl CoA reductase   
 +
|2.74         
 +
|  −
 +
|}
 +
 +
===Subcellular localization===
 +
* '''''Os05g0343400''''' localizes to the nucleus and activates the expression of defense-related genes.
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[File:图片3.png|200px|thumb|left|figure 2.]]
 +
[[File:图片4.png|200px|thumb|right|figure 2.(continued)]]
 +
WRKY proteins can possess one or more WRKY domains and, as with other transcription factors, the nature of the DNA-binding domain forms a basis for categorizing different members of the WRKY family. WRKY proteins containing a single WRKY domain are group II proteins; those with two are group I. The group II WRKY proteins are further subdivided intosubgroups a–e based on the presence of short conserved structural motifs . A third group, group III, contains a single WRKY domain with a variant zinc-finger CX7CX23HXC. Compared with domains from groups Ia and II proteins, the terminal histidine of the zinc-finger of groups Ib and III is replaced with cysteine and the spacing is altered within group III. Group IV WRKY proteins contain the WRKY motif, but lack a complete zinc-finger.
  
You can also add sub-section(s) at will.
+
numerous WRKY gene duplications occurred after the divergence of the monocotyledons from dicotyledons some 50–80 million years ago. Early origin for the WRKY family in primitive eukaryotes, before the emergence of the plant phyla, and its gross expansion during the course of plant evolutionary radiation, likely because of selective pressures favoring greater adaptability. Group I WRKY genes represent the ancestral form, with other groups arising later through losses and gains of a WRKY domain, and that this family originated some 1.8–2 billion years ago. the C-terminal domains are required for DNA-binding activity, thus are constrained in their ability to mutate without losing function, whereas the N-terminal domains mediate protein-protein interactions and may be less functionally constrained . group Ia genes arose from a fusion of two group II WRKY genes evolved at an early time.<ref>Christian A. Ross;Yue Liu;Qingxi J. Shen (2007). "The WRKY Gene Family in Rice (Oryza sativa)." Journal of Integrative Plant Biology 49(6): 827-842.</ref>
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Biotechnology Research Center, The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657, Japan
 +
* National Institute of Agrobiological Resources, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
 +
* Department of Life Science, Meiji University, 1-1-1 Higashimita, Tama-ku, Kawasaki, Kanagawa 216-0011, Japan
 +
* Plant Acquired Immunity Research Unit, Discovery Research Institute, RIKEN, 2-1 Hirosawa, Wako, Saitama 351-0198, Japan
 +
* Meiji Seika Kaisha Ltd., 760 Morooka, Kohoku-ku, Yokohama, Kanagawa 222-8567, Japan
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Chujo T, Takai R, Akimoto-Tomiyama C, Ando S, Minami E, Nagamura Y, Kaku H,
 +
Shibuya N, Yasuda M, Nakashita H, Umemura K, Okada A, Okada K, Nojiri H, Yamane
 +
H. Involvement of the elicitor-induced gene OsWRKY53 in the expression of
 +
defense-related genes in rice. Biochim Biophys Acta. 2007
 +
Jul-Aug;1769(7-8):497-505. PubMed PMID: 17532485.
 +
 
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os05g0343400|
 
Description = WRKY transcription factor 53 (Transcription factor WRKY12)|
 
Version = NM_001061787.1 GI:115463304 GeneID:4338474|
 
Length = 2368 bp|
 
Definition = Oryza sativa Japonica Group Os05g0343400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
 
AP = Chromosome 5:16128079..16130446|
 
CDS = 16128193..16128504,16128618..16128782,16128881..16129341,16129441..16129617,16129715..16130063<br>|
 
GCID = <gbrowseImage1>
 
name=NC_008398:16128079..16130446
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008398:16128079..16130446
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgtcctcgacgggggggttggaccacgggttcacgttcacgccgccgccgttcatcacgtcgttcaccgagctgctgtcggggggcggtggggacctgctcggcgccggcggtgaggagcgctcgccgagggggttctccagaggcggagcgagggtgggcggcggggtgcccaagttcaagtccgcgcagccgccgagcctgccgctctcgccgccgccggtgtcgccgtcgtcctacttcgccatcccgccggggctcagccccaccgagctgctcgactcccccgtcctcctcagctcctcccatatcttggcgtccccgaccaccggtgcaatcccggctcagaggtacgactggaaggccagcgccgatctcatcgcttctcagcaagatgacagccgcggcgacttctccttccacaccaactccgacgccatggccgcgcaaccggcctctttcccttccttcaaggagcaagagcagcaagtggtcgagtcgagcaagaacggcgccgccgccgcgtcgagcaacaagagcggcggcggcgggaacaacaagctggaggacgggtacaactggaggaagtacgggcagaagcaggtgaaggggagcgagaacccgaggagctactacaagtgcacctacaacggctgctccatgaagaagaaggtggagcgctcgctcgccgacggccgcatcacccagatcgtctacaagggcgcacacaaccaccccaagccgctctccacccgccgcaacgcctcctcctgcgccaccgccgccgcctgcgccgacgacctcgcggcgcccggcgcgggcgcggaccagtactccgccgcgacgcccgagaactcctccgtcacgttcggcgacgacgaggccgacaacgcatcgcaccgcagcgagggcgacgagcccgaagccaagcgctggaaggaggatgctgacaacgagggcagctccggcggcatgggcggcggcgccggcggcaagccggtgcgcgagccgaggcttgtggtgcagacgctgagcgacatcgacatcctcgacgacggcttccggtggaggaagtacggccagaaggtcgtcaagggcaaccccaacccaaggagctactacaagtgcacgacggtgggctgcccggtgcggaagcacgtggagcgggcgtcgcacgacacgcgcgccgtgatcaccacctacgagggcaagcacaaccacgacgtcccggtcggccgcggcggcggcggcggacgcgccccggcgccggcgccgccgacgtcgggggcgatccggccgtcggccgtcgccgccgcccagcaggggccctacaccctcgagatgctccccaaccccgccggcctctacggcggctacggcgccggcgccggcggcgccgcgttcccgcgcaccaaggacgagcggcgggacgacctgttcgtcgagtcgctcctctgctag</cdnaseq>|
 
AA = <aaseq>MASSTGGLDHGFTFTPPPFITSFTELLSGGGGDLLGAGGEERSP                    RGFSRGGARVGGGVPKFKSAQPPSLPLSPPPVSPSSYFAIPPGLSPTELLDSPVLLSS                    SHILASPTTGAIPAQRYDWKASADLIASQQDDSRGDFSFHTNSDAMAAQPASFPSFKE                    QEQQVVESSKNGAAAASSNKSGGGGNNKLEDGYNWRKYGQKQVKGSENPRSYYKCTYN                    GCSMKKKVERSLADGRITQIVYKGAHNHPKPLSTRRNASSCATAAACADDLAAPGAGA                    DQYSAATPENSSVTFGDDEADNASHRSEGDEPEAKRWKEDADNEGSSGGMGGGAGGKP                    VREPRLVVQTLSDIDILDDGFRWRKYGQKVVKGNPNPRSYYKCTTVGCPVRKHVERAS                    HDTRAVITTYEGKHNHDVPVGRGGGGGRAPAPAPPTSGAIRPSAVAAAQQGPYTLEML                    PNPAGLYGGYGAGAGGAAFPRTKDERRDDLFVESLLC</aaseq>|
 
DNA = <dnaseqindica>115..426#540..704#803..1263#1363..1539#1637..1985#actcccgtctcgtcgtctcgttctcgtctccgatcactctcctcctcatcttcgtcacggtctcctcgcttcgctagctcgcttgcttgctggctgagctgtggtacgctcgccatggcgtcctcgacgggggggttggaccacgggttcacgttcacgccgccgccgttcatcacgtcgttcaccgagctgctgtcggggggcggtggggacctgctcggcgccggcggtgaggagcgctcgccgagggggttctccagaggcggagcgagggtgggcggcggggtgcccaagttcaagtccgcgcagccgccgagcctgccgctctcgccgccgccggtgtcgccgtcgtcctacttcgccatcccgccggggctcagccccaccgagctgctcgactcccccgtcctcctcagctcctcccatgtgcgttccgcgtgacacaccttcatcttcttcttctacctttagtgcgcaattgctgtgtagtgtggtgctgatgatgatccatggcgtttgtgcgtgtttgtgcttttcagatcttggcgtccccgaccaccggtgcaatcccggctcagaggtacgactggaaggccagcgccgatctcatcgcttctcagcaagatgacagccgcggcgacttctccttccacaccaactccgacgccatggccgcgcaaccggcctctttcccttccttcaaggtacgtacaaatgcttcagctcatctagctcaacccaagctgaataaactgttgacagtctagctcaccttggttcatgtacgcttgtgctggagcaggagcaagagcagcaagtggtcgagtcgagcaagaacggcgccgccgccgcgtcgagcaacaagagcggcggcggcgggaacaacaagctggaggacgggtacaactggaggaagtacgggcagaagcaggtgaaggggagcgagaacccgaggagctactacaagtgcacctacaacggctgctccatgaagaagaaggtggagcgctcgctcgccgacggccgcatcacccagatcgtctacaagggcgcacacaaccaccccaagccgctctccacccgccgcaacgcctcctcctgcgccaccgccgccgcctgcgccgacgacctcgcggcgcccggcgcgggcgcggaccagtactccgccgcgacgcccgagaactcctccgtcacgttcggcgacgacgaggccgacaacgcatcgcaccgcagcgagggcgacgagcccgaagccaagcgctggtaagcctcacatcatcactcaaatcagcaatcgaagcgtaatatctccatgcgtgtgcgtgtgttcttcttgggtctcatggatgtcatggttttcaggaaggaggatgctgacaacgagggcagctccggcggcatgggcggcggcgccggcggcaagccggtgcgcgagccgaggcttgtggtgcagacgctgagcgacatcgacatcctcgacgacggcttccggtggaggaagtacggccagaaggtcgtcaagggcaaccccaacccaaggtaatcaatcaatcaagctgatcaaaatccgtcgattagtcgattaatcatatctgttcttgcgtctctaataatcaaatctgttcttgaatcgcaggagctactacaagtgcacgacggtgggctgcccggtgcggaagcacgtggagcgggcgtcgcacgacacgcgcgccgtgatcaccacctacgagggcaagcacaaccacgacgtcccggtcggccgcggcggcggcggcggacgcgccccggcgccggcgccgccgacgtcgggggcgatccggccgtcggccgtcgccgccgcccagcaggggccctacaccctcgagatgctccccaaccccgccggcctctacggcggctacggcgccggcgccggcggcgccgcgttcccgcgcaccaaggacgagcggcgggacgacctgttcgtcgagtcgctcctctgctagtcgagccgagccgagccgagctgagctgggccccacatccccctgctcgccacgtggcgtattttcgcctcgccgtatacgtacggccgtatagcgtacgtatacacgctcgcacgccctgcccaacacggcaatacacacatacatactctcgtacacacgtagtagcatacatatacagtatagtaggtggtagtggtagctagctagggagtgagatccaatttgttgattcgttgcaggccactgccacgtgggccacaccggaaacagtacacgcgtatacaccacacttgggatacgcgtacgtacgcacatgtacacgtagttttgtgcctttgtaactgctgagagacaggtcaaataagactgatgaatttttc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001061787.1 RefSeq:Os05g0343400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 15:20, 6 March 2017

The rice Os05g0343400 was reported as OsWRKY53 in 2007 [1] by researchers from Japan.

Annotated Infomation

Gene Symbol

  • Os05g0343400 <=> OsWRKY53,WRKY53

Function

  • WRKY proteins form a large family of plant-specific transcription factors that specifically bind to the W-box elements (T)TGAC(C/T) and appear to play a regulatory role in a variety of stress responses.
  • WRKY proteins have been investigated extensively for their possible involvement in defense responses against attacks by pathogens, mainly in dicotyledonous plants such as Arabidopsis and tobacco.
  • The rice genome is predicted to contain over 100 WRKY (OsWRKY)genes.
  • OsWRKY53 is a common transcription factor in the signal transduction pathways triggered by both chitin oligosaccharide and fungal cerebroside elicitors.
  • OsWRKY53 is a transcription factor that plays important roles in elicitor-induced defense signaling pathways in rice.

Phenotypic analysis

  • Overexpression of OsWRKY53 enhances resistance to rice blast fungus

Expression

  • Northern hybridization revealed a significant increase in the level of WRKY53 mRNA at 6 h after inoculation, after which it decreased gradually
Up-regulated defense-related genes in OsWRKY53-overexpressing transgenic rice cells
Accession no. Annotation Fold change a Chitin oligosaccharide elicitor response b
AK071613 PR-10 (PBZ1) 6.92 +
AK058896 PR-14 6.06 +
AK058921 PR-14 5.98
AK073267 chitinase 5.30 +
AK073978 peroxidase 4.18
AK111104 PR -5 3.97 +
AK102505 chitinase 3.67 +
AK102307 peroxidase 3.56 +
AK063935 cinnamoyl CoA reductase 2.74

Subcellular localization

  • Os05g0343400 localizes to the nucleus and activates the expression of defense-related genes.

Evolution

figure 2.
figure 2.(continued)

WRKY proteins can possess one or more WRKY domains and, as with other transcription factors, the nature of the DNA-binding domain forms a basis for categorizing different members of the WRKY family. WRKY proteins containing a single WRKY domain are group II proteins; those with two are group I. The group II WRKY proteins are further subdivided intosubgroups a–e based on the presence of short conserved structural motifs . A third group, group III, contains a single WRKY domain with a variant zinc-finger CX7CX23HXC. Compared with domains from groups Ia and II proteins, the terminal histidine of the zinc-finger of groups Ib and III is replaced with cysteine and the spacing is altered within group III. Group IV WRKY proteins contain the WRKY motif, but lack a complete zinc-finger.

numerous WRKY gene duplications occurred after the divergence of the monocotyledons from dicotyledons some 50–80 million years ago. Early origin for the WRKY family in primitive eukaryotes, before the emergence of the plant phyla, and its gross expansion during the course of plant evolutionary radiation, likely because of selective pressures favoring greater adaptability. Group I WRKY genes represent the ancestral form, with other groups arising later through losses and gains of a WRKY domain, and that this family originated some 1.8–2 billion years ago. the C-terminal domains are required for DNA-binding activity, thus are constrained in their ability to mutate without losing function, whereas the N-terminal domains mediate protein-protein interactions and may be less functionally constrained . group Ia genes arose from a fusion of two group II WRKY genes evolved at an early time.[2]

Labs working on this gene

  • Biotechnology Research Center, The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657, Japan
  • National Institute of Agrobiological Resources, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
  • Department of Life Science, Meiji University, 1-1-1 Higashimita, Tama-ku, Kawasaki, Kanagawa 216-0011, Japan
  • Plant Acquired Immunity Research Unit, Discovery Research Institute, RIKEN, 2-1 Hirosawa, Wako, Saitama 351-0198, Japan
  • Meiji Seika Kaisha Ltd., 760 Morooka, Kohoku-ku, Yokohama, Kanagawa 222-8567, Japan

References

  1. Chujo T, Takai R, Akimoto-Tomiyama C, Ando S, Minami E, Nagamura Y, Kaku H, Shibuya N, Yasuda M, Nakashita H, Umemura K, Okada A, Okada K, Nojiri H, Yamane H. Involvement of the elicitor-induced gene OsWRKY53 in the expression of defense-related genes in rice. Biochim Biophys Acta. 2007 Jul-Aug;1769(7-8):497-505. PubMed PMID: 17532485.
  2. Christian A. Ross;Yue Liu;Qingxi J. Shen (2007). "The WRKY Gene Family in Rice (Oryza sativa)." Journal of Integrative Plant Biology 49(6): 827-842.

Structured Information