|
|
| (56 intermediate revisions by 3 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os01g0785400''''' was reported as '''''OsGH3.1''''' in 2009 <ref name="ref1" /> by researchers from France. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | [[File:Mature transgenic rice plants overexpressing OsGH3.1.jpg|right|thumb|197px|'''Figure 1.''' ''Mature transgenic rice plants overexpressing OsGH3.1.<ref name="ref1" />.'']] |
| | + | ===Gene Symbol=== |
| | + | *'''''Os01g0785400''''' '''''<=>''''' '''''OsGH3-1, OsGH3.1, LC1, GH3.1, OsLC1''''' |
| | ===Function=== | | ===Function=== |
| − | GH3 is one kind of early auxin-responsive genes that widely exists in numerous plants. GH3 belongs to the luciferase superfamily and contains highly conserved regions and variable regions. The GH3 proteins are classified into three groups on the basis of the protein structure and function, and group II GH3 genes encode IAA–amido synthetases, which help to maintain auxin homeostasis by conjugating excess IAA to amino acids. Previous studies showed that the GH3 proteins in Arabidopsis modulate multiple developmental processes including photo-morphogenesis, light and auxin signaling, and auxin homeostasis. In rice, GH3 proteins have been structurally analyzed and studies showed that OsGH3-2 participates in the microRNA-mediated auxin signal transduction pathway, OsGH3-8 maintains auxin homeostasis and functions in basal disease resistance, and OsGH3-13 regulates plant architecture and drought tolerance.<ref name="ref1"/> | + | * GH3 genes are main components of the hormonal mechanism regulating growth and development and, hence, are deeply involved in a broad range of physiological processes..<ref name="ref1"/> |
| | + | * They are implicated in hormonal homeostasis through the conjugation to amino acids of the free form of essential plant growth regulators such as indoleacetic and jasmonic acids. |
| | | | |
| − | ===Structure=== | + | ===Phenotypic analysis=== |
| − | Please input structure information here.
| + | * '''''OsGH3.1''''' overexpression in rice caused dwarfism and significantly reduced both free auxin content and cell elongation. |
| | + | * Functional classification of the transcriptomic profiling revealed that most genes involved in auxin biosynthesis and auxin signaling inhibition were induced and repressed, respectively. |
| | + | * Many genes related to cell organization and biogenesis were also significantly downregulated. The survey also showed that, although the response to abiotic stresses was not clearly stimulated, OsGH3.1 overexpression did activate a significant number of defense-related genes. |
| | + | * In successive bioassays, it was demonstrated that the resistance of rice plants to pathogen infection, evaluated with two different Magnaporthe grisea strains, was higher in the transformants overexpressing '''''OsGH3.1'''''. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | * '''''OsGH3.1''''' Is Expressed in Various Tissues. qRT–PCR analysis revealed that '''''OsGH3.1''''' is expressed in roots, shoots, flowers, seedlings, leaves, and sheaths, with a higher expression in collars. |
| | | | |
| − | ====Overexpression==== | + | ==References== |
| − | Please input overexpression information here.
| + | <references> |
| − | | + | <ref name="ref1">Domingo C, Andrés F, Tharreau D, Iglesias DJ, Talón M. Constitutive expression |
| − | ====Mutation==== | + | of OsGH3.1 reduces auxin content and enhances defense response and resistance to |
| − | Please input mutation information here.
| + | a fungal pathogen in rice. Mol Plant Microbe Interact. 2009 Feb;22(2):201-10. |
| − | | + | doi: 10.1094/MPMI-22-2-0201. PubMed PMID: 19132872. |
| − | ===Evolution===
| + | </ref> |
| − | Please input evolution information here.
| |
| − | | |
| − | You can also add sub-section(s) at will.
| |
| | | | |
| − | ==Labs working on this gene==
| + | </references> |
| − | Please input related labs here.
| |
| − | | |
| − | ==References==
| |
| − | Please input cited references here.
| |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os01g0785400|
| |
| − | Description = GH3 auxin-responsive promoter family protein|
| |
| − | Version = NM_001051002.1 GI:115440374 GeneID:4327043|
| |
| − | Length = 2486 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os01g0785400, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
| |
| − | AP = Chromosome 1:35064294..35066779|
| |
| − | CDS = 35064438..35064763,35064906..35065804,35065915..35066522|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008394:35064294..35066779
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008394:35064294..35066779
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgccggaagcaccgaccgccaagacagcaccggcctacggctacgcccccggggcgcacgccgaggcgctcgagttcatcgagcacgtcacggcgaacgccgggcaggtgcagcggcgcgtgctcggcgagatcctggcgcagaacgcgccggccgagtacctgcgccggtacggaatccccgggtcccccgacgttgtcgacgccttccgccgcctcgtcccgctcgtcacatacgagggcctccagccagacatcctccgcatcgccaacggcgacacctcgccgatcttctccgggaagcctatctccgaattcctcacgagctcgggcacgtcgggaggggagaggaagctcatgccgaccatcgccgacgagatgaacaggcggtcgctgctgtacagcctgctgatgccggtgatgagccagtcggtgtccgggctcgacaaaggcaaggcgatgtacctgctcttcgtgaaggcggagtcgcgcacgccgggcgggctcgcggcgcggccggtgctcacaagctactaccggagccggcagttcctcgaccgtccgcgcgacccctacacatcttacacgagccccgacgaggccatcctgtgcgtggactcctaccagagcatgtacgcgcagctgctctgcggcctcgtccaccgcgccgacgtgctgcgcgtgggcgccgtgttcgcctccggcttcctccgcgccatccatttcctcgagaagcactgggcgcgcctctgccacgacatccgcaccggcgagctcgacccggagatcaccgaccgcgtggtgcgcgacgccgtcgggcgggtgctccgcgccgacccggcgctcgccgacgcgatcgaggacgagtgcgctagggcgtcgtgggagggcatcatccggcgcctgtggccacgcaccaagtacatcgacgtgatcgtgaccggcaccatgtcgcagtacatcccgacgctcgagttctacggcggcggcctgccgctgacgtgcaccatgtacgcctcttcggagtgctacttcggcctcaacctgaatcccatgtgcaagcccagcgacgtcgcctacacgctcatccccaccatgtgctactacgagttcctccccgtcaattgcaacaatgccactgccgaggcgagccaccgcgacctcgtcgacctggtcgacgtaaagctcgggcacgagtacgagctcgtggtcaccacgtattccgggttgtatcgttatcgcgtgggcgacgtgctgagggtggcggggttcaagaacaaggccccgatgttcagcttcgtgcggcggcagaacgtggcgctgagcgtcgactcggacaagacggacgagacggagctgcacgcggcggtgagcggcgcggtgcagcacctggcgccgttcggcgcgtcgctggtggagtacacgagctacgcggacgcggccaccatcccgggccactacgtgctgttctgggagctgcgcgccggcagcacggcggtgccggcgtccgtgttcgaggagtgctgcctgtccgtggaggaggcactgaacagcgtctaccggcagggccgcgcgtgcgacaggtccatcggcccgctcgagatacgcgtcgtggcggagggcaccttcgacaagctcatggactacgcgatcagccggggcgcgtccatcaaccagtacaaggcgccgcggtgcgtgcgccctggcccggtcgtcgagctgctcgacgcgagggtgcagggcaagtacttcagtcccaagtgccccaagtggagccccgggaacaagcaatggaacaaaagcaaggatctggtcggcaagggagacgcctaa</cdnaseq>|
| |
| − | AA = <aaseq>MPEAPTAKTAPAYGYAPGAHAEALEFIEHVTANAGQVQRRVLGE ILAQNAPAEYLRRYGIPGSPDVVDAFRRLVPLVTYEGLQPDILRIANGDTSPIFSGKP ISEFLTSSGTSGGERKLMPTIADEMNRRSLLYSLLMPVMSQSVSGLDKGKAMYLLFVK AESRTPGGLAARPVLTSYYRSRQFLDRPRDPYTSYTSPDEAILCVDSYQSMYAQLLCG LVHRADVLRVGAVFASGFLRAIHFLEKHWARLCHDIRTGELDPEITDRVVRDAVGRVL RADPALADAIEDECARASWEGIIRRLWPRTKYIDVIVTGTMSQYIPTLEFYGGGLPLT CTMYASSECYFGLNLNPMCKPSDVAYTLIPTMCYYEFLPVNCNNATAEASHRDLVDLV DVKLGHEYELVVTTYSGLYRYRVGDVLRVAGFKNKAPMFSFVRRQNVALSVDSDKTDE TELHAAVSGAVQHLAPFGASLVEYTSYADAATIPGHYVLFWELRAGSTAVPASVFEEC CLSVEEALNSVYRQGRACDRSIGPLEIRVVAEGTFDKLMDYAISRGASINQYKAPRCV RPGPVVELLDARVQGKYFSPKCPKWSPGNKQWNKSKDLVGKGDA</aaseq>|
| |
| − | DNA = <dnaseqindica>145..470#613..1511#1622..2229#cacaaaccaagctccataccgctgcctacatctctggttagtagccaccaaggtccaaggagtaacacgctccgtgagagaccgaaatccagggagcacaaattgcacatttgcaccaagcacactcgctgcagctgcagtgacatgccggaagcaccgaccgccaagacagcaccggcctacggctacgcccccggggcgcacgccgaggcgctcgagttcatcgagcacgtcacggcgaacgccgggcaggtgcagcggcgcgtgctcggcgagatcctggcgcagaacgcgccggccgagtacctgcgccggtacggaatccccgggtcccccgacgttgtcgacgccttccgccgcctcgtcccgctcgtcacatacgagggcctccagccagacatcctccgcatcgccaacggcgacacctcgccgatcttctccgggaagcctatctccgaattcctcacgaggtatagcacaatatataacgtgacatgttcatgcttccccgtgtgtgtacgcacgcacgctgctgcgtgcaaaacctagaaagacgtacgagttcatatctgtacagatcttcatgcaatggaatttcatcatgtccaccagctcgggcacgtcgggaggggagaggaagctcatgccgaccatcgccgacgagatgaacaggcggtcgctgctgtacagcctgctgatgccggtgatgagccagtcggtgtccgggctcgacaaaggcaaggcgatgtacctgctcttcgtgaaggcggagtcgcgcacgccgggcgggctcgcggcgcggccggtgctcacaagctactaccggagccggcagttcctcgaccgtccgcgcgacccctacacatcttacacgagccccgacgaggccatcctgtgcgtggactcctaccagagcatgtacgcgcagctgctctgcggcctcgtccaccgcgccgacgtgctgcgcgtgggcgccgtgttcgcctccggcttcctccgcgccatccatttcctcgagaagcactgggcgcgcctctgccacgacatccgcaccggcgagctcgacccggagatcaccgaccgcgtggtgcgcgacgccgtcgggcgggtgctccgcgccgacccggcgctcgccgacgcgatcgaggacgagtgcgctagggcgtcgtgggagggcatcatccggcgcctgtggccacgcaccaagtacatcgacgtgatcgtgaccggcaccatgtcgcagtacatcccgacgctcgagttctacggcggcggcctgccgctgacgtgcaccatgtacgcctcttcggagtgctacttcggcctcaacctgaatcccatgtgcaagcccagcgacgtcgcctacacgctcatccccaccatgtgctactacgagttcctccccgtcaattgcaacaatgccactgccgaggcgagccaccgcgacctcgtcgacctggtcgacgtaaagctcgggcacgagtacgagctcgtggtcaccacgtattccggtaaatctgccttacctcttcgacacataacgtggccgcgcgcgatggatgatatatattcttatatgcagtagtaatatatataattaacagttttgcgattgtgacagggttgtatcgttatcgcgtgggcgacgtgctgagggtggcggggttcaagaacaaggccccgatgttcagcttcgtgcggcggcagaacgtggcgctgagcgtcgactcggacaagacggacgagacggagctgcacgcggcggtgagcggcgcggtgcagcacctggcgccgttcggcgcgtcgctggtggagtacacgagctacgcggacgcggccaccatcccgggccactacgtgctgttctgggagctgcgcgccggcagcacggcggtgccggcgtccgtgttcgaggagtgctgcctgtccgtggaggaggcactgaacagcgtctaccggcagggccgcgcgtgcgacaggtccatcggcccgctcgagatacgcgtcgtggcggagggcaccttcgacaagctcatggactacgcgatcagccggggcgcgtccatcaaccagtacaaggcgccgcggtgcgtgcgccctggcccggtcgtcgagctgctcgacgcgagggtgcagggcaagtacttcagtcccaagtgccccaagtggagccccgggaacaagcaatggaacaaaagcaaggatctggtcggcaagggagacgcctaatattgaagctagagggtgatgatctgatcgagtatttgtgtgagctggtaattaattaacggtacatgcatatggtcattggtcgatatgtttctttagggatatgataattcatgtttgaattatctctgatgctgcgagaggatcgaatagttatgagatgacgacttagcctatatgatcatttgctttactctttctctgctgtaacgcagtatatgttatttcctccgtctcaaaatataagcatttttagt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051002.1 RefSeq:Os01g0785400]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |