|
|
| (35 intermediate revisions by 3 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os01g0785400''''' was reported as '''''OsGH3.1''''' in 2009 <ref name="ref1" /> by researchers from France. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | [[File:Mature transgenic rice plants overexpressing OsGH3.1.jpg|right|thumb|197px|'''Figure 1.''' ''Mature transgenic rice plants overexpressing OsGH3.1.<ref name="ref1" />.'']] |
| | + | ===Gene Symbol=== |
| | + | *'''''Os01g0785400''''' '''''<=>''''' '''''OsGH3-1, OsGH3.1, LC1, GH3.1, OsLC1''''' |
| | ===Function=== | | ===Function=== |
| − | GH3 is one kind of early auxin-responsive genes that widely exists in numerous plants. GH3 belongs to the luciferase superfamily and contains highly conserved regions and variable regions. The GH3 proteins are classified into three groups on the basis of the protein structure and function, and group II GH3 genes encode IAA–amido synthetases, which help to maintain auxin homeostasis by conjugating excess IAA to amino acids. Previous studies showed that the GH3 proteins in Arabidopsis modulate multiple developmental processes including photo-morphogenesis, light and auxin signaling, and auxin homeostasis. In rice, GH3 proteins have been structurally analyzed and studies showed that OsGH3-2 participates in the microRNA-mediated auxin signal transduction pathway, OsGH3-8 maintains auxin homeostasis and functions in basal disease resistance, and OsGH3-13 regulates plant architecture and drought tolerance.<ref name="ref1"/> | + | * GH3 genes are main components of the hormonal mechanism regulating growth and development and, hence, are deeply involved in a broad range of physiological processes..<ref name="ref1"/> |
| | + | * They are implicated in hormonal homeostasis through the conjugation to amino acids of the free form of essential plant growth regulators such as indoleacetic and jasmonic acids. |
| | | | |
| − | ===Gene Family=== | + | ===Phenotypic analysis=== |
| − | [[File:GH3 gene family in rice.jpg|right|500px|]]
| + | * '''''OsGH3.1''''' overexpression in rice caused dwarfism and significantly reduced both free auxin content and cell elongation. |
| − | The information on rice genomic sequence provides a powerful tool to identify putative homologous proteins by database searches with genes of known function from other organisms. The overall analysis of the complete genome of rice revealed that auxin-inducible GH3 gene family is comprised of 12 members(Table1). However, in A. thaliana, 19 GH3 genes, along with an additional partial gene (coding only for amino terminal third of the protein), have been reported.
| + | * Functional classification of the transcriptomic profiling revealed that most genes involved in auxin biosynthesis and auxin signaling inhibition were induced and repressed, respectively. |
| − | | + | * Many genes related to cell organization and biogenesis were also significantly downregulated. The survey also showed that, although the response to abiotic stresses was not clearly stimulated, OsGH3.1 overexpression did activate a significant number of defense-related genes. |
| − | ===Genomic organization and chromosomal distribution===
| + | * In successive bioassays, it was demonstrated that the resistance of rice plants to pathogen infection, evaluated with two different Magnaporthe grisea strains, was higher in the transformants overexpressing '''''OsGH3.1'''''. |
| − | | |
| − | 1.Exon–intron organization of rice GH3 genes.Coding sequences of OsGH3 genes are disrupted by one to four introns except for OsGH3-6 and -9, which do not harbor any intron. Although the exon–intron organization of OsGH3 genes in terms of their numbers does not seem to be very similar, their intron phasing is highly conserved, which is indicative of exon shuffling.(Fig.1)
| |
| − | [[File:Exon–intron organization of rice GH3 genes.jpg|500px|]]
| |
| − | Fig.1 Exon–intron organization of rice GH3 genes.
| |
| − | | |
| − | 2.Genomic distribution of GH3 genes on rice chromosomes. White ovals on the chromosomes (vertical bars) indicate the position of centromeres. The arrows next to gene names show the direction of transcription. The numbers in parentheses designate the position of the first exon of corresponding GH3 gene in megabases (Mb) on rice chromosome pseudomolecules available at TIGR (release 3). The chromosome numbers are indicated at the top of each bar.(Fig.2)
| |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | * '''''OsGH3.1''''' Is Expressed in Various Tissues. qRT–PCR analysis revealed that '''''OsGH3.1''''' is expressed in roots, shoots, flowers, seedlings, leaves, and sheaths, with a higher expression in collars. |
| − | | |
| − | ====Overexpression====
| |
| − | Please input overexpression information here.
| |
| − | | |
| − | ====Mutation====
| |
| − | Please input mutation information here.
| |
| − | | |
| − | ===Evolution===
| |
| − | Please input evolution information here.
| |
| − | | |
| − | You can also add sub-section(s) at will.
| |
| − | | |
| − | ==Labs working on this gene==
| |
| − | Please input related labs here.
| |
| | | | |
| | ==References== | | ==References== |
| | <references> | | <references> |
| − | <ref name="ref1">Zhao S Q, Xiang J J, Xue H W. Studies on the Rice Leaf INCLINATION1 (LC1), an IAA–amido Synthetase, Reveal the Effects of Auxin in Leaf Inclination Control[J]. Molecular plant, 2013, 6(1): 174-187.</ref> | + | <ref name="ref1">Domingo C, Andrés F, Tharreau D, Iglesias DJ, Talón M. Constitutive expression |
| | + | of OsGH3.1 reduces auxin content and enhances defense response and resistance to |
| | + | a fungal pathogen in rice. Mol Plant Microbe Interact. 2009 Feb;22(2):201-10. |
| | + | doi: 10.1094/MPMI-22-2-0201. PubMed PMID: 19132872. |
| | + | </ref> |
| | + | |
| | </references> | | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os01g0785400|
| |
| − | Description = GH3 auxin-responsive promoter family protein|
| |
| − | Version = NM_001051002.1 GI:115440374 GeneID:4327043|
| |
| − | Length = 2486 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os01g0785400, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
| |
| − | AP = Chromosome 1:35064294..35066779|
| |
| − | CDS = 35064438..35064763,35064906..35065804,35065915..35066522|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008394:35064294..35066779
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008394:35064294..35066779
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgccggaagcaccgaccgccaagacagcaccggcctacggctacgcccccggggcgcacgccgaggcgctcgagttcatcgagcacgtcacggcgaacgccgggcaggtgcagcggcgcgtgctcggcgagatcctggcgcagaacgcgccggccgagtacctgcgccggtacggaatccccgggtcccccgacgttgtcgacgccttccgccgcctcgtcccgctcgtcacatacgagggcctccagccagacatcctccgcatcgccaacggcgacacctcgccgatcttctccgggaagcctatctccgaattcctcacgagctcgggcacgtcgggaggggagaggaagctcatgccgaccatcgccgacgagatgaacaggcggtcgctgctgtacagcctgctgatgccggtgatgagccagtcggtgtccgggctcgacaaaggcaaggcgatgtacctgctcttcgtgaaggcggagtcgcgcacgccgggcgggctcgcggcgcggccggtgctcacaagctactaccggagccggcagttcctcgaccgtccgcgcgacccctacacatcttacacgagccccgacgaggccatcctgtgcgtggactcctaccagagcatgtacgcgcagctgctctgcggcctcgtccaccgcgccgacgtgctgcgcgtgggcgccgtgttcgcctccggcttcctccgcgccatccatttcctcgagaagcactgggcgcgcctctgccacgacatccgcaccggcgagctcgacccggagatcaccgaccgcgtggtgcgcgacgccgtcgggcgggtgctccgcgccgacccggcgctcgccgacgcgatcgaggacgagtgcgctagggcgtcgtgggagggcatcatccggcgcctgtggccacgcaccaagtacatcgacgtgatcgtgaccggcaccatgtcgcagtacatcccgacgctcgagttctacggcggcggcctgccgctgacgtgcaccatgtacgcctcttcggagtgctacttcggcctcaacctgaatcccatgtgcaagcccagcgacgtcgcctacacgctcatccccaccatgtgctactacgagttcctccccgtcaattgcaacaatgccactgccgaggcgagccaccgcgacctcgtcgacctggtcgacgtaaagctcgggcacgagtacgagctcgtggtcaccacgtattccgggttgtatcgttatcgcgtgggcgacgtgctgagggtggcggggttcaagaacaaggccccgatgttcagcttcgtgcggcggcagaacgtggcgctgagcgtcgactcggacaagacggacgagacggagctgcacgcggcggtgagcggcgcggtgcagcacctggcgccgttcggcgcgtcgctggtggagtacacgagctacgcggacgcggccaccatcccgggccactacgtgctgttctgggagctgcgcgccggcagcacggcggtgccggcgtccgtgttcgaggagtgctgcctgtccgtggaggaggcactgaacagcgtctaccggcagggccgcgcgtgcgacaggtccatcggcccgctcgagatacgcgtcgtggcggagggcaccttcgacaagctcatggactacgcgatcagccggggcgcgtccatcaaccagtacaaggcgccgcggtgcgtgcgccctggcccggtcgtcgagctgctcgacgcgagggtgcagggcaagtacttcagtcccaagtgccccaagtggagccccgggaacaagcaatggaacaaaagcaaggatctggtcggcaagggagacgcctaa</cdnaseq>|
| |
| − | AA = <aaseq>MPEAPTAKTAPAYGYAPGAHAEALEFIEHVTANAGQVQRRVLGE ILAQNAPAEYLRRYGIPGSPDVVDAFRRLVPLVTYEGLQPDILRIANGDTSPIFSGKP ISEFLTSSGTSGGERKLMPTIADEMNRRSLLYSLLMPVMSQSVSGLDKGKAMYLLFVK AESRTPGGLAARPVLTSYYRSRQFLDRPRDPYTSYTSPDEAILCVDSYQSMYAQLLCG LVHRADVLRVGAVFASGFLRAIHFLEKHWARLCHDIRTGELDPEITDRVVRDAVGRVL RADPALADAIEDECARASWEGIIRRLWPRTKYIDVIVTGTMSQYIPTLEFYGGGLPLT CTMYASSECYFGLNLNPMCKPSDVAYTLIPTMCYYEFLPVNCNNATAEASHRDLVDLV DVKLGHEYELVVTTYSGLYRYRVGDVLRVAGFKNKAPMFSFVRRQNVALSVDSDKTDE TELHAAVSGAVQHLAPFGASLVEYTSYADAATIPGHYVLFWELRAGSTAVPASVFEEC CLSVEEALNSVYRQGRACDRSIGPLEIRVVAEGTFDKLMDYAISRGASINQYKAPRCV RPGPVVELLDARVQGKYFSPKCPKWSPGNKQWNKSKDLVGKGDA</aaseq>|
| |
| − | DNA = <dnaseqindica>145..470#613..1511#1622..2229#cacaaaccaagctccataccgctgcctacatctctggttagtagccaccaaggtccaaggagtaacacgctccgtgagagaccgaaatccagggagcacaaattgcacatttgcaccaagcacactcgctgcagctgcagtgacatgccggaagcaccgaccgccaagacagcaccggcctacggctacgcccccggggcgcacgccgaggcgctcgagttcatcgagcacgtcacggcgaacgccgggcaggtgcagcggcgcgtgctcggcgagatcctggcgcagaacgcgccggccgagtacctgcgccggtacggaatccccgggtcccccgacgttgtcgacgccttccgccgcctcgtcccgctcgtcacatacgagggcctccagccagacatcctccgcatcgccaacggcgacacctcgccgatcttctccgggaagcctatctccgaattcctcacgaggtatagcacaatatataacgtgacatgttcatgcttccccgtgtgtgtacgcacgcacgctgctgcgtgcaaaacctagaaagacgtacgagttcatatctgtacagatcttcatgcaatggaatttcatcatgtccaccagctcgggcacgtcgggaggggagaggaagctcatgccgaccatcgccgacgagatgaacaggcggtcgctgctgtacagcctgctgatgccggtgatgagccagtcggtgtccgggctcgacaaaggcaaggcgatgtacctgctcttcgtgaaggcggagtcgcgcacgccgggcgggctcgcggcgcggccggtgctcacaagctactaccggagccggcagttcctcgaccgtccgcgcgacccctacacatcttacacgagccccgacgaggccatcctgtgcgtggactcctaccagagcatgtacgcgcagctgctctgcggcctcgtccaccgcgccgacgtgctgcgcgtgggcgccgtgttcgcctccggcttcctccgcgccatccatttcctcgagaagcactgggcgcgcctctgccacgacatccgcaccggcgagctcgacccggagatcaccgaccgcgtggtgcgcgacgccgtcgggcgggtgctccgcgccgacccggcgctcgccgacgcgatcgaggacgagtgcgctagggcgtcgtgggagggcatcatccggcgcctgtggccacgcaccaagtacatcgacgtgatcgtgaccggcaccatgtcgcagtacatcccgacgctcgagttctacggcggcggcctgccgctgacgtgcaccatgtacgcctcttcggagtgctacttcggcctcaacctgaatcccatgtgcaagcccagcgacgtcgcctacacgctcatccccaccatgtgctactacgagttcctccccgtcaattgcaacaatgccactgccgaggcgagccaccgcgacctcgtcgacctggtcgacgtaaagctcgggcacgagtacgagctcgtggtcaccacgtattccggtaaatctgccttacctcttcgacacataacgtggccgcgcgcgatggatgatatatattcttatatgcagtagtaatatatataattaacagttttgcgattgtgacagggttgtatcgttatcgcgtgggcgacgtgctgagggtggcggggttcaagaacaaggccccgatgttcagcttcgtgcggcggcagaacgtggcgctgagcgtcgactcggacaagacggacgagacggagctgcacgcggcggtgagcggcgcggtgcagcacctggcgccgttcggcgcgtcgctggtggagtacacgagctacgcggacgcggccaccatcccgggccactacgtgctgttctgggagctgcgcgccggcagcacggcggtgccggcgtccgtgttcgaggagtgctgcctgtccgtggaggaggcactgaacagcgtctaccggcagggccgcgcgtgcgacaggtccatcggcccgctcgagatacgcgtcgtggcggagggcaccttcgacaagctcatggactacgcgatcagccggggcgcgtccatcaaccagtacaaggcgccgcggtgcgtgcgccctggcccggtcgtcgagctgctcgacgcgagggtgcagggcaagtacttcagtcccaagtgccccaagtggagccccgggaacaagcaatggaacaaaagcaaggatctggtcggcaagggagacgcctaatattgaagctagagggtgatgatctgatcgagtatttgtgtgagctggtaattaattaacggtacatgcatatggtcattggtcgatatgtttctttagggatatgataattcatgtttgaattatctctgatgctgcgagaggatcgaatagttatgagatgacgacttagcctatatgatcatttgctttactctttctctgctgtaacgcagtatatgttatttcctccgtctcaaaatataagcatttttagt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051002.1 RefSeq:Os01g0785400]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |