|
|
| (5 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os06g0600400''''' was reported as '''''CYP734A4''''' in 2011 <ref name="ref1" /> by researchers from Japan. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os06g0600400''''' '''''<=>''''' '''''OsCYP734A4''''','''''CYP734A4''''' |
| | + | |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | * Catabolism of brassinosteroids regulates the endogenous level of bioactive brassinosteroids. |
| − | Rice CYP734As are multifunctional, multisubstrate enzymes that control the endogenous bioactive brassinosteroid content both by direct inactivation of CS and by the suppression of CS biosynthesis by decreasing the levels of brassinosteroid precursors.In addition, rice CYP734As can catalyze hydroxylation and the second and third oxidations to produce aldehyde and carboxylate groups at C-26 in vitro.Two P450s,CYP734A1/BAS1 and CYP72C1/SOB7/CHI2/SHK1, also act in the inactivation of brassinosteroids by means of different enzymatic activities.
| + | * The rice '''''CYP734A4''''' are multifunctional, multisubstrate enzymes that control the endogenous bioactive brassinosteroid content both by direct inactivation of CS and by the suppression of CS biosynthesis by decreasing the levels of brassinosteroid precursors. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | * Overexpression of rice '''''Os06g0600400''''' in transgenic rice gave typical brassinosteroid-deficient phenotypes. These transformants were deficient in both the bioactive CS and its precursors downstream of the C-22 hydroxylation step. |
| − | | + | * Consistent with this result, recombinant rice CYP734As utilized a range of C-22 hydroxylated brassinosteroid intermediates as substrates. |
| − | Expression of CYP 734A genes in wild-type and mutant rice.
| + | * In addition, rice CYP734As can catalyze hydroxylation and the second and third oxidations to produce aldehyde and carboxylate groups at C-26 in vitro. |
| − | | |
| − | ===Evolution===
| |
| − | Please input evolution information here.
| |
| | | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * Institute for Advanced Research, Nagoya University, Nagoya, Aichi 464-8601, Japan, |
| − | 1,overexpression of CYP734A genes in transgenic rice.
| + | * Institute for Chemical Research, Kyoto University, Uji, Kyoto 611-0011, Japan, |
| − | 2,isolation of CYP734A1/BAS1-like genes from rice.
| + | * Department of Chemistry, Joetsu University of Education, Joetsu, Niigata 943-8512, Japan, |
| − | 3,catalytic activities of rice CYP734As.
| + | * RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan, |
| − | 4,determination off the position oxidized by CYP734A2.
| + | * RIKEN Advanced Science Institute, Wako, Saitama 351-0198, Japan, and |
| − | 5,substrate specificity of CYP734A2.
| + | * Graduate School of Agricultural Science, Kobe University, Kobe 657-8501, Japan |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| − | 1. Tomoaki Sakamoto;Ayami Kawabe;Asako Tokida-Segawa;Bun-ichi Shimizu;Suguru Takatsuto;Yukihisa Shimada;Shozo Fujioka;Masaharu Mizutani Rice CYP734As function as multisubstrate and multifunctional enzymes in brassinosteroid catabolism. The Plant Journal, 2011, 67(1): 1-12
| + | * <ref name="ref1"> |
| | + | Sakamoto T, Kawabe A, Tokida-Segawa A, Shimizu B, Takatsuto S, Shimada Y, |
| | + | Fujioka S, Mizutani M. Rice CYP734As function as multisubstrate and |
| | + | multifunctional enzymes in brassinosteroid catabolism. Plant J. 2011 |
| | + | Jul;67(1):1-12. doi: 10.1111/j.1365-313X.2011.04567.x. PubMed PMID: 21418356. |
| | + | </ref> |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os06g0600400|
| |
| − | Description = Cytochrome P450 family protein|
| |
| − | Version = NM_001064535.1 GI:115468801 GeneID:4341450|
| |
| − | Length = 2534 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os06g0600400, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
| |
| − | AP = Chromosome 6:24581718..24584251|
| |
| − | CDS = 24581820..24582093,24582172..24582395,24582502..24582749,24582848..24583250,24583353..24583820<br>|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008399:24581718..24584251
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008399:24581718..24584251
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgatggaggcggtggccgtggcggcggcggtgctgctgctgctgcacgtggcggcgagggtggcggacgcggtgtggtggcggccgaggcggctggaggcgcacttcgcggggcagggggtgcgcggcccgccgtaccggttcctcgtcgggtgcgtgagggagatggtggcgctcatggcggaggccaccgcgaagcccatgccgcccgccgcgccgcacaacgcgctccccagggtgctcgcgttctaccactactggaggaagatctacgggccgacgttcttgatttggttcgggccgacaccgcggctcacggtggcggagccggagatggtgcgggagatcttcctcacgcgcgccgaggcgttcgaccgctacgaggcgcaccccgtggtccggcagctggagggcgacgggctcgtcagcctccacggcgacaagtgggctcaccaccgccgcgtcctcacccccggcttctaccccgacaacctcaaccggctggtgccgcacgtcggcaggtcggtggcggcgctggcggagaggtggcgcgccatggcgtgcgccggcggcggcgaggtggaggtggacgtggcggagtggttccaggcggtggcggaggaggccatcacgcgcgccacgttcggccgcagctacgactccggccgcgtcgtgttccgcttgcaggcccgcctcatggcgttcgcctccgaggccttccgcaaggtgctcgtcccgggatacaggttcctgccgaccaagaagaacaggatgtcgtggggcctggacagggagatcaggcgcggcctggtccggctcatcggccggcgcagtggcggcgacggcggcgaggaagacgagaccaccaccgagctcaaagacaagcaggacagcggcttcaacgacttgctggggctcatgatcaatgccggcgtggacaggacgatgccggtggaggacatggtggaggagtgcaagaccttcttcttcgccggcaagcagacgaccaccaacctgctcacctgggccaccgtgctgctcgccatgcacccggactggcaggaccgcgcccgccgcgaggtcctcgccgtctgcggcgatgccgccggcgagctccccaccaaggaccacctccccaagctcaagacgctcgggatgatcctcaacgagacgctgcgcctgtacccgccggcggtggccaccatccgccgcgccaagttcgacgtcaccctcggcggcggtggcgacggcgacgccggaggcatccatatcccgcgcgacacggagctgctcgtcccgatcatggcgatccaccacgacgcccggttgtgggggcccgacgcggcccagttcaacccggcgaggttcgccagcggcgcggcgcgcgcggcgaagcacccgctcgccttcatcccgttcgggctgggctcccgcatgtgcatcggccagagcctcgccatcctcgaggccaagctcaccatggccgtcctcctccagcgcttcgacctcgcgctctcgcccacctacgtgcacgcccccaccgtgctgatgctgctccacccgcagtacggcgcgccgttgatcttccggccgcgccaatctcagccgtccaattag</cdnaseq>|
| |
| − | AA = <aaseq>MMEAVAVAAAVLLLLHVAARVADAVWWRPRRLEAHFAGQGVRGP PYRFLVGCVREMVALMAEATAKPMPPAAPHNALPRVLAFYHYWRKIYGPTFLIWFGPT PRLTVAEPEMVREIFLTRAEAFDRYEAHPVVRQLEGDGLVSLHGDKWAHHRRVLTPGF YPDNLNRLVPHVGRSVAALAERWRAMACAGGGEVEVDVAEWFQAVAEEAITRATFGRS YDSGRVVFRLQARLMAFASEAFRKVLVPGYRFLPTKKNRMSWGLDREIRRGLVRLIGR RSGGDGGEEDETTTELKDKQDSGFNDLLGLMINAGVDRTMPVEDMVEECKTFFFAGKQ TTTNLLTWATVLLAMHPDWQDRARREVLAVCGDAAGELPTKDHLPKLKTLGMILNETL RLYPPAVATIRRAKFDVTLGGGGDGDAGGIHIPRDTELLVPIMAIHHDARLWGPDAAQ FNPARFASGAARAAKHPLAFIPFGLGSRMCIGQSLAILEAKLTMAVLLQRFDLALSPT YVHAPTVLMLLHPQYGAPLIFRPRQSQPSN</aaseq>|
| |
| − | DNA = <dnaseqindica>103..376#455..678#785..1032#1131..1533#1636..2103#aaacccccaacccaaccgccgccaccactcaccggcgcaaccaccggcggcgacctgatctctctgcgtttgtgtgctctgtttcaagaaacaggggaggagatgatggaggcggtggccgtggcggcggcggtgctgctgctgctgcacgtggcggcgagggtggcggacgcggtgtggtggcggccgaggcggctggaggcgcacttcgcggggcagggggtgcgcggcccgccgtaccggttcctcgtcgggtgcgtgagggagatggtggcgctcatggcggaggccaccgcgaagcccatgccgcccgccgcgccgcacaacgcgctccccagggtgctcgcgttctaccactactggaggaagatctacggtatgttgaggacggatggattttgtgtgcttgctcgtgtctgatcagatggattaatggcggtcgtcgcggttgcagggccgacgttcttgatttggttcgggccgacaccgcggctcacggtggcggagccggagatggtgcgggagatcttcctcacgcgcgccgaggcgttcgaccgctacgaggcgcaccccgtggtccggcagctggagggcgacgggctcgtcagcctccacggcgacaagtgggctcaccaccgccgcgtcctcacccccggcttctaccccgacaacctcaacgtgagtctctcctctgtttcttcatcctccgatcgatcggggcgcacccgcgatgacgacgacgacgatggctgacacgtgctctgtctctgtctctctcttgcagcggctggtgccgcacgtcggcaggtcggtggcggcgctggcggagaggtggcgcgccatggcgtgcgccggcggcggcgaggtggaggtggacgtggcggagtggttccaggcggtggcggaggaggccatcacgcgcgccacgttcggccgcagctacgactccggccgcgtcgtgttccgcttgcaggcccgcctcatggcgttcgcctccgaggccttccgcaaggtgctcgtcccgggatacaggtacggtacacgccacgaacaacccaaaaaactcccaaacgattcgccattctcgccgaaattgggctcacggttggcgccggaattcgatcgaacaggttcctgccgaccaagaagaacaggatgtcgtggggcctggacagggagatcaggcgcggcctggtccggctcatcggccggcgcagtggcggcgacggcggcgaggaagacgagaccaccaccgagctcaaagacaagcaggacagcggcttcaacgacttgctggggctcatgatcaatgccggcgtggacaggacgatgccggtggaggacatggtggaggagtgcaagaccttcttcttcgccggcaagcagacgaccaccaacctgctcacctgggccaccgtgctgctcgccatgcacccggactggcaggaccgcgcccgccgcgaggtcctcgccgtctgcggcgatgccgccggcgagctccccaccaaggaccacctccccaagctcaagacggtacgcacaccaaaccatatccatggcccagtgggggtattcccgtaattccacgccgacaaaagtctcaccttgttggttctcgctgtcatcttcttccagctcgggatgatcctcaacgagacgctgcgcctgtacccgccggcggtggccaccatccgccgcgccaagttcgacgtcaccctcggcggcggtggcgacggcgacgccggaggcatccatatcccgcgcgacacggagctgctcgtcccgatcatggcgatccaccacgacgcccggttgtgggggcccgacgcggcccagttcaacccggcgaggttcgccagcggcgcggcgcgcgcggcgaagcacccgctcgccttcatcccgttcgggctgggctcccgcatgtgcatcggccagagcctcgccatcctcgaggccaagctcaccatggccgtcctcctccagcgcttcgacctcgcgctctcgcccacctacgtgcacgcccccaccgtgctgatgctgctccacccgcagtacggcgcgccgttgatcttccggccgcgccaatctcagccgtccaattagctactattactaggtaggagtactagtattgctagctaggaaaagacaggaaagcccctgtccgttgtgtgcatagtgacacaggaaaaggccaagagacaactaacaaaaggctctgcccgtggcaggggcagggccggattccgaaaatgccctcgctaacagactagtggtacgatcagagcacaacttttagggatttgatgggtcagaaactctcagaagagaagaagagagacagtagtagggtagtagcagtagccccacacatccactgctcggttgcttccatttgttctcttctccttcgcgtggattctggtgtatgtatcgatcaatgcatgtacctgtatgtgtgtgttgtgtacaggggtgtgattattttgattcgggacacccggcacttcacagcaaaggagaattccatttgg</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001064535.1 RefSeq:Os06g0600400]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |