Difference between revisions of "Os09g0457900"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
 
(44 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os09g0457900''''' was reported as '''''OsEATB''''' in 2011 <ref name="ref1" /> by researchers from China. <ref name="ref1" />
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:76HF6.jpg|right|thumb|527px|'''Figure 6.''' ''Effect of transgenic OsEATB on rice yield traits.<ref name="ref1" />.'']]
 +
===Gene Symbol===
 +
*'''''Os09g0457900''''' '''''<=>''''' '''''OsERF#102, OsERF102, AP2/EREBP#123, AP2/EREBP123, OsEATB, EATB'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* Plant height is a decisive factor in plant architecture. Rice (Oryza sativa) plants have the potential for rapid internodal elongation, which determines plant height. A large body of physiological research has shown that ethylene and gibberellin are involved in this process.
 +
* The APETALA2 (AP2)/Ethylene-Responsive Element Binding Factor (ERF) family of transcriptional factors is only present in the plant kingdom.
 +
* '''''OsEATB''''' reduces rice plant height and panicle length at maturity, promoting the branching potential of both tillers and spikelets.
 +
* '''''OsEATB''''' Is a Novel Rice AP2/ERF
 +
* '''''OsEATB'''''  Negatively Regulates Ethylene-Induced Enhancement of GA Responsiveness by Reducing GA Biosynthesis
 +
* '''''OsEATB''''' Regulates Rice Yield Components through the Promotion of Tillering and Panicle Branching
 +
 
 +
===Phenotypic analysis===
 +
* Overexpression of '''''OsEATB''''' Decreases the Endogenous GA Level in Rice
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* OsEATB Expression Is Negatively Regulated by Ethylene, ABA, and Abiotic Stress in Rice
 
+
* Ectopic expression of OsEATB showed that the cross talk between ethylene and gibberellin, which is mediated by OsEATB, might underlie differences in rice internode elongation.  
===Evolution===
+
* Analyses of gene expression demonstrated that OsEATB restricts ethylene-induced enhancement of gibberellin responsiveness during the internode elongation process by down-regulating the gibberellin biosynthetic gene, ent-kaurene synthase A.
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* State Key Laboratory of Genetic Engineering, Institute of Genetics, School of Life Sciences, Fudan University,Shanghai 200433, China.
 +
* Key Laboratory of Analytical Chemistry for Biology and Medicine, Department of Chemistry, Wuhan University, Wuhan 430072, China.
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1">Weiwei Qi, Fan Sun, Qianjie Wang, Mingluan Chen, Yunqing Huang, Yu-Qi Feng,
 +
Xiaojin Luo, and Jinshui Yang(2011) Rice Ethylene-Response AP2/ERF Factor OsEATB
 +
Restricts Internode Elongation by Down-Regulating
 +
a Gibberellin Biosynthetic Gene. Plant Physiol 157:216-228.</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os09g0457900|
 
Description = Similar to AP2 domain containing protein RAP2.6 (Fragment)|
 
Version = NM_001069906.1 GI:115479554 GeneID:4347266|
 
Length = 1100 bp|
 
Definition = Oryza sativa Japonica Group Os09g0457900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:17959811..17960910|
 
CDS = 17959874..17960698|
 
GCID = <gbrowseImage1>
 
name=NC_008402:17959811..17960910
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:17959811..17960910
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgaccaagaaggtgataccggccatggcggcggcgaggcaggattcttgcaagaccaagcttgatgagcgtgggggtagtcatcaggctccgagctccgcgcggtggatctcgtccgagcaggagcacagcatcatcgtcgcggctctgcggtacgtggtgtccgggtgcaccacgccgccgccggagatcgtcacggtggcgtgcggggaggcgtgtgctctgtgcggcatcgacggctgtctcgggtgcgacttctttggggccgaggcggcggggaacgaggaggcggtaatggcgacggattatgctgctgctgctgctgcggccgcggtggcaggaggatcaggcgggaagagggttaggcggaggaggaagaagaacgtgtaccgcggcgtgcggcatcggccgtgggggaagtgggcagcggagatacgcgacccgcgccgcgcggtgcgcaagtggctcgggacgttcgacaccgccgaggaggccgccagggcgtacgaccgcgccgccctcgagttccgcggcgcgcgcgcgaagctcaacttcccgtgctccgagcctttgcccatgcccagccaaagaaacggcaatggcggcgatgctgtcacggcggcgacgacaacggcagagcagatgactccgactctgtcgccgtgcagcgcggatgccgaggagacgacgacgccggtggattggcagatgggcgcggacgaagccggcagcaaccagctctgggatggcttgcaggacctgatgaagctggatgaagcggacacctggttcccgccattttccggtgcagcgtctagtttttga</cdnaseq>|
 
AA = <aaseq>MTKKVIPAMAAARQDSCKTKLDERGGSHQAPSSARWISSEQEHS                    IIVAALRYVVSGCTTPPPEIVTVACGEACALCGIDGCLGCDFFGAEAAGNEEAVMATD                    YAAAAAAAAVAGGSGGKRVRRRRKKNVYRGVRHRPWGKWAAEIRDPRRAVRKWLGTFD                    TAEEAARAYDRAALEFRGARAKLNFPCSEPLPMPSQRNGNGGDAVTAATTTAEQMTPT                    LSPCSADAEETTTPVDWQMGADEAGSNQLWDGLQDLMKLDEADTWFPPFSGAASSF</aaseq>|
 
DNA = <dnaseqindica>64..888#aacgacctcaagcacactactagctccggctcacttagctccctactgatcactggaacactcatgaccaagaaggtgataccggccatggcggcggcgaggcaggattcttgcaagaccaagcttgatgagcgtgggggtagtcatcaggctccgagctccgcgcggtggatctcgtccgagcaggagcacagcatcatcgtcgcggctctgcggtacgtggtgtccgggtgcaccacgccgccgccggagatcgtcacggtggcgtgcggggaggcgtgtgctctgtgcggcatcgacggctgtctcgggtgcgacttctttggggccgaggcggcggggaacgaggaggcggtaatggcgacggattatgctgctgctgctgctgcggccgcggtggcaggaggatcaggcgggaagagggttaggcggaggaggaagaagaacgtgtaccgcggcgtgcggcatcggccgtgggggaagtgggcagcggagatacgcgacccgcgccgcgcggtgcgcaagtggctcgggacgttcgacaccgccgaggaggccgccagggcgtacgaccgcgccgccctcgagttccgcggcgcgcgcgcgaagctcaacttcccgtgctccgagcctttgcccatgcccagccaaagaaacggcaatggcggcgatgctgtcacggcggcgacgacaacggcagagcagatgactccgactctgtcgccgtgcagcgcggatgccgaggagacgacgacgccggtggattggcagatgggcgcggacgaagccggcagcaaccagctctgggatggcttgcaggacctgatgaagctggatgaagcggacacctggttcccgccattttccggtgcagcgtctagtttttgagctagtgttattagatctcaaccgttggattagattactggaaggccattcatttattcgtttcattgtatagctaattagctatacttcattgtttgtgcagagcacgttttttaggagtaccgtcttatacatatttttttgtacagagtagaaagtaacaagaattttgtatattgatggaatagattatttccaattaatatttgcgc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069906.1 RefSeq:Os09g0457900]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 15:30, 7 March 2017

The rice Os09g0457900 was reported as OsEATB in 2011 [1] by researchers from China. [1]

Annotated Information

Figure 6. Effect of transgenic OsEATB on rice yield traits.[1].

Gene Symbol

  • Os09g0457900 <=> OsERF#102, OsERF102, AP2/EREBP#123, AP2/EREBP123, OsEATB, EATB

Function

  • Plant height is a decisive factor in plant architecture. Rice (Oryza sativa) plants have the potential for rapid internodal elongation, which determines plant height. A large body of physiological research has shown that ethylene and gibberellin are involved in this process.
  • The APETALA2 (AP2)/Ethylene-Responsive Element Binding Factor (ERF) family of transcriptional factors is only present in the plant kingdom.
  • OsEATB reduces rice plant height and panicle length at maturity, promoting the branching potential of both tillers and spikelets.
  • OsEATB Is a Novel Rice AP2/ERF
  • OsEATB Negatively Regulates Ethylene-Induced Enhancement of GA Responsiveness by Reducing GA Biosynthesis
  • OsEATB Regulates Rice Yield Components through the Promotion of Tillering and Panicle Branching

Phenotypic analysis

  • Overexpression of OsEATB Decreases the Endogenous GA Level in Rice

Expression

  • OsEATB Expression Is Negatively Regulated by Ethylene, ABA, and Abiotic Stress in Rice
  • Ectopic expression of OsEATB showed that the cross talk between ethylene and gibberellin, which is mediated by OsEATB, might underlie differences in rice internode elongation.
  • Analyses of gene expression demonstrated that OsEATB restricts ethylene-induced enhancement of gibberellin responsiveness during the internode elongation process by down-regulating the gibberellin biosynthetic gene, ent-kaurene synthase A.

Labs working on this gene

  • State Key Laboratory of Genetic Engineering, Institute of Genetics, School of Life Sciences, Fudan University,Shanghai 200433, China.
  • Key Laboratory of Analytical Chemistry for Biology and Medicine, Department of Chemistry, Wuhan University, Wuhan 430072, China.

References

  1. 1.0 1.1 1.2 Weiwei Qi, Fan Sun, Qianjie Wang, Mingluan Chen, Yunqing Huang, Yu-Qi Feng, Xiaojin Luo, and Jinshui Yang(2011) Rice Ethylene-Response AP2/ERF Factor OsEATB Restricts Internode Elongation by Down-Regulating a Gibberellin Biosynthetic Gene. Plant Physiol 157:216-228.

Structured Information