Difference between revisions of "Os09g0457900"

From RiceWiki
Jump to: navigation, search
(Function)
(Labs working on this gene)
 
(29 intermediate revisions by 3 users not shown)
Line 1: Line 1:
The rice gene Os09g0457900,namely '''OsEATB''',is a Ethylene-Response AP2/ERF Factor and restricts ethylene-induced enhancement of gibberellin responsiveness during the internode elongation process by down-regulating the gibberellin biosynthetic gene, ent-kaurene synthase A.<ref name="ref1" />
+
The rice '''''Os09g0457900''''' was reported as '''''OsEATB''''' in 2011 <ref name="ref1" /> by researchers from China. <ref name="ref1" />
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:76HF6.jpg|right|thumb|527px|'''Figure 6.''' ''Effect of transgenic OsEATB on rice yield traits.<ref name="ref1" />.'']]
 +
===Gene Symbol===
 +
*'''''Os09g0457900''''' '''''<=>''''' '''''OsERF#102, OsERF102, AP2/EREBP#123, AP2/EREBP123, OsEATB, EATB'''''
 +
 
===Function===
 
===Function===
*'''Effect of Transgenic OsEATB on Rice Internode Elongation'''
+
* Plant height is a decisive factor in plant architecture. Rice (Oryza sativa) plants have the potential for rapid internodal elongation, which determines plant height. A large body of physiological research has shown that ethylene and gibberellin are involved in this process.
Plant height is not only a decisive factor in plant
+
* The APETALA2 (AP2)/Ethylene-Responsive Element Binding Factor (ERF) family of transcriptional factors is only present in the plant kingdom.
architecture but also an important agronomic trait that
+
* '''''OsEATB''''' reduces rice plant height and panicle length at maturity, promoting the branching potential of both tillers and spikelets.  
is directly linked to yield potential <ref name="ref2" /><ref name="ref3" />. The OsEATB transgenic lines
+
* '''''OsEATB''''' Is a Novel Rice AP2/ERF
showed dwarf phenotypes, indicating that the internodal
+
* '''''OsEATB''''' Negatively Regulates Ethylene-Induced Enhancement of GA Responsiveness by Reducing GA Biosynthesis
elongation process was suppressed by OsEATB
+
* '''''OsEATB''''' Regulates Rice Yield Components through the Promotion of Tillering and Panicle Branching
overexpression. For experiments, we selected two
 
transgenic lines: 401003 and 401006 (20 individual
 
plants of each line). The transgenic plants and 9311
 
control plants were cultivated in the same conditions, and plant height was determined at maturity. The
 
average plant heights of the control, 401003, and
 
401006 lines were 121, 113, and 106 cm, respectively.
 
Thus, 401003 and 401006 plants were 6.61% and
 
12.40% shorter than the control, respectively '''(Fig. 3A;
 
Supplemental Table S1)'''. Furthermore, every elongated
 
internode was shortened, especially the fourth internode,
 
which was shortened by an average of 56.30%
 
(Fig. 3A). OsEATB negatively regulated plant height at
 
every growth stage of rice plants. The transgenic
 
plants showed a dwarf phenotype from the three-leaf
 
stage to the mature stage '''(Fig. 3B; see Fig. 6, A and B,
 
below)'''. The panicles also showed reduced elongation, demonstrating that panicle internodes were shortened
 
as well '''(see Fig. 6C below)'''.
 
The plant hormone GA is involved in deepwaterresponsive
 
internode elongation <ref name="ref4" />. A number of genes encoding GA biosynthetic
 
or signaling pathways have been identified as being
 
associated with this rapid process <ref name="ref3" />. To examine the regulation of GA sensitivity in
 
OsEATB transgenic lines, we treated wild-type and
 
transgenic seedlings with 10, 50, and 100 mM GA3 at
 
the four-leaf stage. Under these conditions, both
 
seedlings showed rapid elongation after the 24-h
 
treatments, and OsEATB transgenic seedlings did
 
not show negative sensitivity to GA treatments compared
 
with the control seedlings during this process
 
'''(Fig. 3, B and C)'''. Together, these results suggested
 
that OsEATB negatively regulates the elongation process
 
of every internode, in every organ, at every
 
growth stage and that the responsiveness of transgenic
 
seedlings to GA is not impaired. Many GAresponsive
 
dwarf plants that are deficient in the
 
biosynthesis of active GAs have been characterized
 
in various plant species <ref name="ref5" /><ref name="ref6" />. These findings, together with our results,
 
led us to conclude that there is negative regulation of
 
GA biosynthesis in the transgenic plants. To test this hypothesis, we used microarray analysis
 
to compare the expression of GA biosynthetic genes
 
between OsEATB transgenic 401006 seedlings and
 
control seedlings at the four-leaf stage. ent-Kaurene
 
is an early intermediate in the GA biosynthesis pathway:
 
ent-kaurene synthase A (CPS) catalyzes the cyclization
 
of geranylgeranyl diphosphate (GGDP) to
 
ent-copalyl diphosphate (CDP), which is then converted
 
to ent-kaurene by ent-kaurene synthase B '''(KS;
 
Supplemental Fig. S2)'''<ref name="ref7" />. The
 
microarray analysis results showed that the expression
 
of rice CPS OsCPS2 in OsEATB transgenic seedlings
 
was sharply down-regulated (10.32-fold less than the
 
expression level in 9311 wild-type seedlings). In contrast,
 
the expression of GIBBERELLIN 20-OXIDASE
 
(GA20ox2) was 2.77-fold greater in OsEATB transgenic
 
seedlings than in 9311 wild-type seedlings '''(Table I)'''.
 
GA20ox is one of the major GA biosynthetic genes,
 
and the levels of GAs are homeostatically modulated
 
through negative feedback regulation of GA20ox expression
 
<ref name="ref28" />. In addition, no significant
 
differences were found between the OsEATB transgenic
 
seedlings and the wild type in the expression of
 
OsCPS1, OsKS1, OsKO2, and OsKAO. To confirm these
 
results, we used real-time PCR analysis to examine the
 
expression of OsCPS2 and GA20ox2 genes in four-leafstage
 
transgenic line 401006 and 401003 plants and control plants '''(Fig. 3D)'''. Expression of these two GA
 
biosynthesis-related genes was similarly affected by
 
the overexpression of OsEATB to the microarray results.
 
We also analyzed the expression of OsCPS1,
 
OsKS1, OsKO2, and OsKAO, and in agreement with
 
the microarray data, no significant differences in expression
 
of these genes were found '''(Fig. 3E)'''.<ref name="ref1" />
 
 
 
*'''Effect of Rice OsEATB on GA Biosynthesis during Internode Elongation'''
 
To examine the negative regulatory relationship
 
between OsEATB and OsCPS2 during internode elongation,
 
we examined the expression of these two
 
genes in elongating internodes of 64- to 73-d-old 9311
 
plants '''(Fig. 4A)'''. In elongating internodes of 64-dold
 
plants, OsEATB was expressed at a high level
 
while OsCPS2 was expressed at a much lower level.
 
The expression of OsEATB sharply decreased 3 d
 
later, while that of OsCPS2 increased approximately
 
10-fold. Expression of OsEATB was remarkably decreased
 
from 67 to 73 d, while expression of OsCPS2
 
was slightly increased and then remained almost
 
stable.
 
We compared gene expression in elongating internodes
 
of 67-d-old 401006 transgenic and control
 
plants using real-time quantitative PCR analysis.
 
The genes examined were involved in the GA biosynthesis and GA signaling pathways '''(Fig. 4B)'''.
 
First, we reexamined the expression of OsCPS2 and
 
GA20ox2 at this growth stage. In elongating internodes
 
of transgenic plants, OsCPS2 was down-regulated by
 
11.21-fold while GA20ox2 was up-regulated by 2.03-
 
fold, compared with their respective expression in
 
wild-type plants. In rice, the expression levels of XET
 
(for xyloglucan endotransglycosylase) and UROD (for
 
uroporphyrinogen decarboxylase) are up-regulated by
 
GA treatment, while that of GOX (for glycolate oxidase)
 
is down-regulated <ref name="ref8" />. We investigated
 
the effect of OsEATB on the expression of these
 
three genes. Transgenic lines overexpressing OsEATB
 
showed decreased expression of XET and UROD but
 
slightly increased expression of GOX compared with
 
their respective expression in the wild type. These
 
findings suggested that the GA response was suppressed
 
in the transformants, possibly due to the lack
 
of bioactive GAs. SLENDER RICE1 (SLR1), the only
 
DELLA protein in rice <ref name="ref9" /> ,
 
down-regulates the GA signaling pathway  <ref name="ref10" /> . We evaluated the effect of
 
OsEATB overexpression on this gene and found that
 
expression of SLR1 was down-regulated in transgenic plants. Together, all of these results confirmed that
 
OsEATB negatively regulates the internode elongation
 
process, not via down-regulating GA sensitivity
 
but through restricting GA biosynthesis.<ref name="ref1" />
 
 
 
*'''Effect of Transgenic OsEATB on Rice Tillering and Panicle Branching'''
 
To investigate the function of rice OsEATB on yield
 
traits, we analyzed traits in two transgenic lines
 
(401003 and 401006; 20 individual plants of each
 
line). The transgenic lines and 9311 control plants
 
were cultivated in the same conditions, and we evaluated
 
four yield components: panicles per plant, panicle
 
length, spikelets per panicle, and grain number
 
per panicle. The transgenic plants produced more
 
tillers than the control 9311 lines at the six-leaf stage
 
'''(Fig. 6B)'''. In rice, the tiller is a specialized grain-bearing
 
branch that forms on the unelongated basal internode.
 
The tiller grows independently of the mother stem
 
(culm) by means of its own adventitious roots <ref name="ref11" /> . At maturity, transgenic plants had produced
 
16.95% more panicles than wild-type plants '''(Fig. 6, A
 
and D; Supplemental Table S1)'''.
 
Spikelets are grass-specific, flower-bearing branches
 
that form on each panicle branch. They consist of primary, secondary, and sometimes higher order panicle
 
branches <ref name="ref12" />. We counted the
 
spikelets per panicle in transgenic plants and wildtype
 
lines. The 35S:OsEATB transformants produced
 
more spikelets than control plants '''(Fig. 6, C and E)'''.We
 
also counted the numbers of primary and secondary
 
branches per panicle. Transgenic lines showed 8.31%
 
more primary spikelets per panicle and 34.41% more
 
secondary branches per panicle compared with the
 
wild type '''(Fig. 6D; Supplemental Table S1)'''. The finding
 
that 35S:OsEATB transformants producedmore secondary
 
braches, more spikelets per panicle, and more
 
panicles per plant suggested that OsEATB activity is
 
responsible for branching in rice.
 
To investigate the effects of OsEATB on rice grain
 
weight, we examined the 1,000-grain weight at random
 
and observed a slight change. The 1,000-grain
 
weight of the control and transgenic lines is about 30.0
 
and 25.5g, respectively. Average numbers of grains per
 
plant of the control, 401003, and 401006 lines were 776,
 
1,096, and 1,254, respectively. The calculated grain
 
weights per plant were about 23.28, 27.95, and 31.98 g,
 
respectively. These results indicated that 401003 and
 
401006 possess increases in grain yield per plant over
 
the control of 20.06% and 37.37% (Fig. 6E; Supplemental
 
Table S1).<ref name="ref1" />
 
 
 
*'''OsEATB Is a Novel Rice AP2/ERF'''
 
ERFs are an important subfamily of AP2/ERF transcription
 
factors, and they have a variety of functions.
 
Several rice ERF genes have been isolated and identified;
 
for example, OsEBP-89 regulates transcription of
 
the rice Wx gene <ref name="ref13" />, and OsEREBP1 is
 
related to the regulation of defense responses <ref name="ref14" />. In this study, we investigated and confirmed
 
the function of a rice AP2/ERF gene, OsEATB.
 
ERFs can be classified into different subgroups based
 
on their function and group motif. Subgroup I, which
 
includes Arabidopsis (Arabidopsis thaliana) AtERF1 and AtERF2 and tomato (Solanum lycopersicum) Pti4,
 
functions as transcriptional activators. Subgroup II,
 
which includes tobacco (Nicotiana tabacum) NtERF3
 
and Arabidopsis AtERF3 and AtERF4, functions as
 
transcriptional repressors. However, the functions of
 
ERF subgroups III and IV remain unclear <ref name="ref17" />. OsEATB cannot be classified into any of the
 
function-known ERF subgroups '''(Fig. 1)'''. Our data
 
show that OsEATB encodes a transcriptional factor
 
that localizes to the nucleus and is constitutively expressed
 
in various tissues '''(Fig. 1)'''. Experimental data
 
from transgenic plants showed that OsEATB plays a
 
crucial role in regulating the rice internode elongation
 
process '''(Figs. 2–4)'''.
 
Ethylene is perceived by a family of His kinase-like
 
receptors and, downstream, by EIN2, a novel protein
 
containing an integral membrane domain. In the
 
nucleus, the EIN3 family of DNA-binding proteins
 
regulates ethylene-responsive transcription, and an
 
immediate target of EIN3 is the AP2/EREBP family
 
<ref name="ref29" />. As a result, most ERFs are
 
regulated by ethylene. Many ERF proteins have been
 
shown to bind to the specific ERE, the GCC box. In our
 
study, we examined the binding activity of OsEATB to
 
the GCC box '''(Fig. 1)'''. At the same time, we found that
 
the expression level of OsEATB was sharply decreased
 
by ethylene '''(Fig. 5)'''. Consequently, our results show that this gene is involved in the regulation of ethylene-related. responses. OsEATB overexpression dramatically
 
suppressed the internode elongation process
 
'''(Fig. 3)''' and made seedlings hypersensitive to NaCl
 
and ABA. In addition, the expression of this gene was
 
down-regulated by both NaCl and ABA '''(Fig. 5)'''.
 
Ethylene is mostly reported to trigger the internodal
 
elongation process via GA <ref name="ref10" /> <ref name="ref15" /> , and many ERF genes are
 
induced by abiotic stress conditions in rice <ref name="ref16" /> <ref name="ref17" />. Thus, rice OsEATB might be a
 
negative balance regulator of the ethylene-responsive
 
pathway.<ref name="ref1" />
 
 
 
*'''OsEATB Negatively Regulates Ethylene-Induced'''
 
Enhancement of GA Responsiveness by Reducing
 
GA Biosynthesis
 
Plant height is a decisive factor in plant architecture.
 
In rice, there is the potential for rapid internodal
 
elongation, and the degree of elongation determines
 
plant height. This rapid growth response is best demonstrated
 
in deepwater rice, especially in the process of
 
submergence tolerance <ref name="ref18" />. Sub1A is an
 
ERF that confers submergence tolerance to rice. This
 
tolerance is mediated by SLR1, which restricts the
 
response to GA. Sub1A augments SLR1 and SLRL1
 
gene expression, which counteract the elevated responsiveness
 
to GA promoted by the increase in ethylene <ref name="ref19" /> <ref name="ref10" />. The ERF
 
genes SK1 and SK2 allow rice to adapt to deep water.
 
Under deepwater conditions, ethylene accumulates in
 
the plant and induces the expression of these two genes.
 
These SK genes encoding ERFs trigger internode elongation
 
in deepwater rice via GA. In contrast to Sub1A,
 
SK1 and SK2 may stimulate GA responses <ref name="ref15" />. Both SK genes and SUB1A encode ERFs
 
and are related toGA, but they have opposing functions
 
in regulating plant height in response to flooding. It is
 
interesting that gene family members in the same
 
subgroup confer different functions related to internode
 
elongation. In conclusion, there is a self-balance
 
of ethylene-induced enhancement of the GA response
 
during the internodal elongation process.
 
It is possible that cross talk mediated by OsEATB
 
between ethylene and GA underlies the differences in
 
rice internode elongation. The OsEATB transgenic seedlings
 
did not show negative sensitivity to GA treatments
 
'''(Fig. 3)''', and the expression-level analysis of the
 
genes involved in GA biosynthesis and GA signaling
 
pathways showed that the GA response is suppressed
 
via down-regulating a key enzyme involved in GA
 
biosynthesis and not through up-regulating the important
 
GA sensitivity repressor '''(Fig. 4)'''. The Arabidopsis
 
GA-deficient mutant dwarf and delayed flowering (ddf1) phenotypes are caused by increased or ectopic expression
 
of a putative AP2 transcription factor, DDF1. DDF1
 
is involved in the down-regulation of GA biosynthesis
 
<ref name="ref6" />. As a potential negative balance
 
regulator of the ethylene-responsive pathway, OsEATB
 
suppresses the internode elongation process through
 
the restriction of GA biosynthesis, specifically downregulating
 
the expression of OsCPS2 '''(Table I; Fig. 3)'''.
 
The mutation line of OsCPS1 showed a dwarf phenotype
 
without flower or seed development, which is a
 
typical phenotype of GA-deficient rice dwarf mutants
 
<ref name="ref30" />. Evidence is presented indicating
 
that OsCPS2 is involved in related secondary metabolism,
 
producing defensive phytochemicals <ref name="ref31" />.The expression of OsCPS2 is sharply negatively
 
related to OsEATB expression, and the endogenous GA
 
level is decreased in OsEATB transgenic plants alongside
 
suppressed expression of OsCPS2 '''(Table II)'''. No
 
significant differences between the OsEATB transgenic
 
seedlings and the wild type in the expression of
 
OsCPS1, OsKS1, OsKO2, and OsKAO were found, and
 
the expression of GA20ox2 was slightly up-regulated for
 
the feedback of GA deficiency. All these experimental
 
results strongly demonstrated that OsCPS2 is also associated
 
with GA biosynthesis. Promoter regions (1,300
 
bp upstream of the translation site) of OsCPS2 do not contain the GCC box motif, suggesting that this gene
 
may not be a direct target of OsEATB. We propose a
 
model for OsEATB-dependent hormonal regulation of
 
internode elongation in rice '''(Fig. 7)'''. It was suggested
 
that the important function of OsEATB is to negatively
 
regulate the ethylene-induced enhancement of GA responsiveness
 
during the internode elongation process
 
by decreasing GA biosynthesis.<ref name="ref1" />
 
  
*'''OsEATB Regulates Rice Yield Components through the Promotion of Tillering and Panicle Branching'''
+
===Phenotypic analysis===
Food security for the ever-increasing world population
+
* Overexpression of '''''OsEATB''''' Decreases the Endogenous GA Level in Rice
largely relies on the grain yield of crop plants
 
<ref name="ref32" />. The critical components to determine
 
rice yield include grain number and grain weight.
 
Grain number is contingent on the number of spikelets
 
per panicle and the number of panicles per plant. The
 
number of panicles is mainly determined by the plant
 
architecture and the spikelets per panicle by panicle
 
morphology (i.e. the number of primary/secondary/
 
tertiary branches on each panicle)<ref name="ref20" />.
 
Overexpression of OsEATB decreased plant height
 
'''(Fig. 3)''' and increased the numbers of panicles per
 
plant and spikelets per panicle '''(Fig. 6)'''. More panicles
 
and spikelets resulted in a 37.37% increase in grain
 
yield, notwithstanding that the 1,000-grain weight was
 
15.00% lower in transgenic lines than in the control
 
'''(Fig. 6)'''. The results of this study show that OsEATB, as
 
a member of the AP2/ERF family, positively regulates
 
rice yield components through the promotion of rice
 
tillering and panicle branching. The basic structure of a rice panicle is determined
 
by the pattern of branch formation. In rice, the MONO
 
CULM1 (MOC1) and LAX PANICLE genes are necessary
 
for branch meristem formation <ref name="ref12" />. MOC1 positively regulates tillering by promoting
 
axillary meristem outgrowth <ref name="ref21" /><ref name="ref22" />. Although the molecular mechanisms that underlie
 
the cross talk between plant height and branching
 
are poorly understood, it is well known that rice
 
plant height is strongly negatively correlated with
 
tiller number <ref name="ref23" /><ref name="ref24" />.
 
Higher yields are typically obtained from dwarf crops
 
<ref name="ref25" />. The finding that transgenic
 
rice plants harboring the MOC1 gene are dwarf but
 
produce more tillers than wild-type plants <ref name="ref21" /> provides a good opportunity to investigate the
 
genetic control network. Our results indicate that
 
overexpression of the OsEATB gene '''(Fig. 2)''' reduces
 
rice plant height and panicle length at maturity, promoting
 
rice branching potential in both tillers and
 
spikelets, possibly via the regulation of both shoot
 
elongation and axillary outgrowth. The short stature
 
reflects the decreased growth of the mother stem,
 
which allows the growth of more tillers, leaves, and
 
panicles and enhances the energy utilization ratio and
 
biomass production. The functions of OsEATB in regulating
 
rice plant architecture include its effects on
 
plant height (decreased internode elongation) and
 
panicle morphology (increased tiller formation).
 
Studies on the rice AP2/ERF gene OsEATB provide
 
an opportunity to identify agriculturally important
 
functions that can be used to improve rice yield components.
 
In addition, this gene provides a model for
 
investigating cross talk between ethylene and GA in
 
the internodal elongation process.<ref name="ref1" />
 
  
 
===Expression===
 
===Expression===
*'''Expression of OsEATB in Transgenic Rice Lines'''
+
* OsEATB Expression Is Negatively Regulated by Ethylene, ABA, and Abiotic Stress in Rice
To investigate the function of OsEATB, we introduced
+
* Ectopic expression of OsEATB showed that the cross talk between ethylene and gibberellin, which is mediated by OsEATB, might underlie differences in rice internode elongation.  
the plasmid 35S:OsEATB containing the
+
* Analyses of gene expression demonstrated that OsEATB restricts ethylene-induced enhancement of gibberellin responsiveness during the internode elongation process by down-regulating the gibberellin biosynthetic gene, ent-kaurene synthase A.
OsEATB gene (Fig. 2A) into indica variety 9311. We
 
produced transgenic plants overexpressing the sense
 
strand of OsEATB. 35S:OsEATB transformants were
 
screened on antibiotic selection medium containing
 
hygromycin. The transgenic plants were checked by
 
PCR using genomic DNA as the template and specific primers (see “Materials and Methods”). Eight independent
 
transformants (T0), regenerated fromhygromycinresistant
 
calli, were shown to contain OsEATB. Eight
 
PCR-positive T1 lines (20 individual plants of each
 
line) shared the same dwarf phenotype. Two transgenic
 
lines (401003 and 401006) were selected for
 
Southern hybridization analysis. A single, specific
 
band of OsEATB transgene was observed in 35S:
 
OsEATB transgenic lines 401003 and 401006 '''(Fig. 2B)'''.
 
These results showed that OsEATB was integrated into
 
the rice genome.
 
The expression level of the OsEATB gene was examined
 
in three-leaf-stage transgenic plants and
 
control plants by real-time PCR analyses '''(Fig. 2C)'''.
 
Expression of OsEATB was 9.77-fold greater in the
 
401006 transgenic plants and 4.00-, 2.83-, and 2.00-fold
 
greater in the 401003, 401005, and 401007 transgenic
 
plants than in 9311 control plants, respectively. These
 
results were further confirmed by RNA hybridization.<ref name="ref1" />
 
 
 
*'''Overexpression of OsEATB Decreases the Endogenous'''
 
GA Level in Rice CPS catalyzes the cyclization of GGDP to CDP,
 
which is then converted to ent-kaurene before going
 
through a series of processes to produce GA and various
 
GA derivatives. Since OsEATB represses the expression
 
of OsCPS2, we determined the endogenous GA
 
level in three-leaf-stage 401006 OsEATB transgenic
 
plants and 9311 control plants, six-leaf-stage 401006
 
and 401003 OsEATB transgenic plants and 9311 control
 
plants. As shown in Table II, the endogenous levels of
 
all GAs tested (i.e. GA12, GA53, GA24, GA19, GA9, GA20,
 
GA4, and GA1) were significantly lower in OsEATB
 
transgenic plants than in the wild type, while the
 
levels of abscisic acid (ABA) and indole-3-acetic acid
 
(IAA) were not significantly changed. Therefore, GA
 
levels are decreased along with the suppression of
 
OsCPS2 expression '''(Supplemental Fig. S2)'''.<ref name="ref1" />
 
 
 
*'''OsEATB Expression Is Negatively Regulated by Ethylene, ABA, and Abiotic Stress in Rice'''
 
OsEATB binds to the ERE, the GCC box, resulting
 
in decreases in the levels in GAs. While increased
 
responsiveness to GA is often associated with an
 
increase in ethylene <ref name="ref15" />, differential
 
expression of OsEATB was observed in 18-d-old
 
(three-leaf stage) rice 9311 seedlings in response to 50
 
mM ethephon treatment '''(Fig. 5A)'''. Ethephon treatment
 
sharply decreased the expression of OsEATB, and
 
expression remained at low levels for 24 h after treatment.
 
Because the expression level of OsEATB was
 
down-regulated by ethephon treatment and OsCPS2 is
 
decreased by OsEATB, we examined the effect of
 
ethylene treatment on OsCPS2. Real-time quantitative
 
PCR analysis was used to investigate the expression of
 
OsEATB and OsCPS2 at 0, 3, 6, 12, and 24 h of ethephon
 
treatment '''(Fig. 5B)'''. Expression of OsCPS2 increased
 
while that of OsEATB was sharply down-regulated by
 
the treatment. Nevertheless, after 12 h of treatment, the
 
expression of OsCPS2 was stabilized to a normal level
 
via the self-balance regulation of other pathways, for it
 
is a key enzyme in GA biosynthesis. This result indicated
 
that an increase in the amount of OsCPS2 in
 
response to ethylene is correlated with the decrease in
 
OsEATB expression responding to ethylene. In rice, most ERF genes are induced by abiotic stress
 
conditions <ref name="ref17" />. To investigate the effect of
 
transgenic OsEATB on the response to abiotic stress in
 
rice, 18-d-old seedlings of 9311 control and transgenic
 
401006 plants were treated with 200 mM NaCl or
 
100 mM ABA '''(Fig. 5, C and D)'''. The transgenic seedlings
 
treated with 200 mM NaCl showed wilting and rolling
 
of leaves, while 9311 control plants showed a significantly
 
higher survival rate '''(Fig. 5C)'''. After 48 h of
 
stress followed by 48 h of watering, almost all of the
 
transgenic plants never recovered, whereas 42% of the
 
control plants survived. The transgenic seedlings
 
showed stronger chlorosis in response to the 100 mM
 
ABA treatment, while the chlorosis of the 9311 control
 
line was slower '''(Fig. 5D)'''. Thus, overexpression of
 
OsEATB made seedlings hypersensitive to NaCl and ABA. We also analyzed whether the expression of
 
OsEATB was regulated by these two conditions. Seedlings
 
(18 d old) of 9311 subjected to a salt treatment
 
(200 mM NaCl in Hoagland solution) showed rapid
 
down-regulation of OsEATB expression within 24 h
 
after the treatment compared with that in the watertreated
 
control plants (Fig. 5A). Moreover, expression
 
of OsEATB was slightly decreased in 18-d-old 9311
 
seedlings in response to ABA treatment (100 mM ABA
 
in Hoagland solution) compared with that in the
 
water-treated control plants '''(Fig. 5A)'''. OsERF3 is upregulated
 
by ethylene treatment<ref name="ref26" /> ,
 
while ABA treatment induces the expression of CPD
 
<ref name="ref276" />). Therefore, we chose OsERF3 as a
 
positive control for ethylene responsiveness and CPD
 
as a positive control for ABA responsiveness. These
 
results strongly suggest that OsEATB is responsive to
 
ethylene and environmental stresses and, therefore,
 
may be involved in the regulation of ethylene-related
 
responses.<ref name="ref1" />
 
 
 
===Evolution===
 
*There are 161 known AP2/ERFs in indica rice, 103 of
 
which are potential ERFs with a single complete AP2
 
domain (http://plntfdb.bio.uni-potsdam.de). Of these
 
103 potential ERFs, 38 cannot be classified into any of
 
the four functional subgroups <ref name="ref17" />, for
 
they lack typical group motifs. We selected OsEATB
 
from these 38 ERFs for further investigation because,
 
like the members of subgroup IV, it contains a nuclear
 
localization signal adjacent to the highly conserved
 
AP2 domain '''(Fig. 1A; Supplemental Fig. S1)'''. Multiple
 
sequence alignment of OsEATB with other known ERF
 
proteins showed that their similarity was restricted to
 
the DNA-binding domain region, and OsEATB could
 
not be classified into any of the ERF subgroups with
 
previously defined functions '''(Fig. 1B)'''. We inferred
 
that OsEATB is a rice ERF that might have a potential
 
new function.
 
Based on the data from the National Center for
 
Biotechnology Information GenBank database (http:// www.ncbi.nlm.nih.gov/), OsEATB has no intron and
 
exists as a single-copy gene. Using PCR, we isolated
 
and cloned its full-length 825-bp open reading frame
 
(ORF) from genomic DNA of indica variety 9311. Sequence
 
data for this article have been deposited at
 
GenBank under accession number EU622934. The
 
825-bp ORF encodes a protein consisting of 274
 
amino acids.We used the yeast one-hybrid system and
 
electrophoretic mobility shift assays to examine the
 
binding activity of OsEATB to the GCC box. As shown
 
in Figure 1C, the first section of each plate shows
 
the yeast reporter strain harboring pHIS-GCC box
 
and pGAD-OsEATB, while the second section shows
 
yeast cells harboring pHIS-muGCC box and pGADOsEATB.
 
The third section of each plate shows yeast
 
cells transformed with pHIS-GCC box and the negative
 
control vector pGAD242, and the fourth section
 
shows yeast cells transformed with pGAD-OsEATB
 
and negative control vector pHIS2.1. The yeast reporter
 
strain containing pHIS-GCC box and pGADOsEATB
 
grew well on both synthetic dextrose (SD)/
 
Trp2Leu2 medium and SD/Trp2Leu2His2/50 mM
 
3-amino-1,2,4-triazole (3-AT) medium. The other three
 
yeast reporter strains grew well on SD/Trp2Leu2
 
medium but not on SD/Trp2Leu2His2/50 mM 3-AT medium. The band corresponding to the GCC boxcontaining
 
labeled probe and purified His fusion
 
recombinant OsEATB protein complex showed a
 
marked mobility shift compared with the free probe
 
band (Fig. 1D). And the muGCC box-containing labeled
 
fragment served as a competitor. These results
 
demonstrated that OsEATB could specifically bind to
 
the GCC box.
 
If OsEATB acts as a transcription factor, then its
 
nuclear localization signal should localize it to the
 
nucleus. To confirm the subcellular localization of
 
OsEATB, we fused the coding sequence of OsEATB
 
with that of GFP under the control of the 35S promoter
 
(35S:OsEATB:GFP) and delivered the construct into
 
onion (Allium cepa) epidermal cells by particle bombardment
 
'''(Fig. 1E)'''. The OsEATB protein localized the
 
GFP signal to the nucleus '''(Fig. 1F)'''.We investigated the
 
tissue expression pattern of OsEATB by reverse transcription
 
(RT)-PCR using rice total mRNA from roots,
 
culms, leaves, and young panicles as the template. The
 
results showed that OsEATB mRNA is expressed
 
constitutively in these four tissues and is expressed
 
at higher levels in roots and leaves than in culms and
 
young panicles '''(Fig. 1G)'''.<ref name="ref1" />
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
*State Key Laboratory of Genetic Engineering, Institute of Genetics, School of Life Sciences, Fudan University,Shanghai 200433, China.
+
* State Key Laboratory of Genetic Engineering, Institute of Genetics, School of Life Sciences, Fudan University,Shanghai 200433, China.
*Key Laboratory of Analytical Chemistry for Biology and Medicine, Department of Chemistry, Wuhan University, Wuhan 430072, China.
+
* Key Laboratory of Analytical Chemistry for Biology and Medicine, Department of Chemistry, Wuhan University, Wuhan 430072, China.
  
 
==References==
 
==References==
Line 525: Line 35:
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os09g0457900|
 
Description = Similar to AP2 domain containing protein RAP2.6 (Fragment)|
 
Version = NM_001069906.1 GI:115479554 GeneID:4347266|
 
Length = 1100 bp|
 
Definition = Oryza sativa Japonica Group Os09g0457900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:17959811..17960910|
 
CDS = 17959874..17960698|
 
GCID = <gbrowseImage1>
 
name=NC_008402:17959811..17960910
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:17959811..17960910
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgaccaagaaggtgataccggccatggcggcggcgaggcaggattcttgcaagaccaagcttgatgagcgtgggggtagtcatcaggctccgagctccgcgcggtggatctcgtccgagcaggagcacagcatcatcgtcgcggctctgcggtacgtggtgtccgggtgcaccacgccgccgccggagatcgtcacggtggcgtgcggggaggcgtgtgctctgtgcggcatcgacggctgtctcgggtgcgacttctttggggccgaggcggcggggaacgaggaggcggtaatggcgacggattatgctgctgctgctgctgcggccgcggtggcaggaggatcaggcgggaagagggttaggcggaggaggaagaagaacgtgtaccgcggcgtgcggcatcggccgtgggggaagtgggcagcggagatacgcgacccgcgccgcgcggtgcgcaagtggctcgggacgttcgacaccgccgaggaggccgccagggcgtacgaccgcgccgccctcgagttccgcggcgcgcgcgcgaagctcaacttcccgtgctccgagcctttgcccatgcccagccaaagaaacggcaatggcggcgatgctgtcacggcggcgacgacaacggcagagcagatgactccgactctgtcgccgtgcagcgcggatgccgaggagacgacgacgccggtggattggcagatgggcgcggacgaagccggcagcaaccagctctgggatggcttgcaggacctgatgaagctggatgaagcggacacctggttcccgccattttccggtgcagcgtctagtttttga</cdnaseq>|
 
AA = <aaseq>MTKKVIPAMAAARQDSCKTKLDERGGSHQAPSSARWISSEQEHS                    IIVAALRYVVSGCTTPPPEIVTVACGEACALCGIDGCLGCDFFGAEAAGNEEAVMATD                    YAAAAAAAAVAGGSGGKRVRRRRKKNVYRGVRHRPWGKWAAEIRDPRRAVRKWLGTFD                    TAEEAARAYDRAALEFRGARAKLNFPCSEPLPMPSQRNGNGGDAVTAATTTAEQMTPT                    LSPCSADAEETTTPVDWQMGADEAGSNQLWDGLQDLMKLDEADTWFPPFSGAASSF</aaseq>|
 
DNA = <dnaseqindica>64..888#aacgacctcaagcacactactagctccggctcacttagctccctactgatcactggaacactcatgaccaagaaggtgataccggccatggcggcggcgaggcaggattcttgcaagaccaagcttgatgagcgtgggggtagtcatcaggctccgagctccgcgcggtggatctcgtccgagcaggagcacagcatcatcgtcgcggctctgcggtacgtggtgtccgggtgcaccacgccgccgccggagatcgtcacggtggcgtgcggggaggcgtgtgctctgtgcggcatcgacggctgtctcgggtgcgacttctttggggccgaggcggcggggaacgaggaggcggtaatggcgacggattatgctgctgctgctgctgcggccgcggtggcaggaggatcaggcgggaagagggttaggcggaggaggaagaagaacgtgtaccgcggcgtgcggcatcggccgtgggggaagtgggcagcggagatacgcgacccgcgccgcgcggtgcgcaagtggctcgggacgttcgacaccgccgaggaggccgccagggcgtacgaccgcgccgccctcgagttccgcggcgcgcgcgcgaagctcaacttcccgtgctccgagcctttgcccatgcccagccaaagaaacggcaatggcggcgatgctgtcacggcggcgacgacaacggcagagcagatgactccgactctgtcgccgtgcagcgcggatgccgaggagacgacgacgccggtggattggcagatgggcgcggacgaagccggcagcaaccagctctgggatggcttgcaggacctgatgaagctggatgaagcggacacctggttcccgccattttccggtgcagcgtctagtttttgagctagtgttattagatctcaaccgttggattagattactggaaggccattcatttattcgtttcattgtatagctaattagctatacttcattgtttgtgcagagcacgttttttaggagtaccgtcttatacatatttttttgtacagagtagaaagtaacaagaattttgtatattgatggaatagattatttccaattaatatttgcgc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069906.1 RefSeq:Os09g0457900]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 15:30, 7 March 2017

The rice Os09g0457900 was reported as OsEATB in 2011 [1] by researchers from China. [1]

Annotated Information

Figure 6. Effect of transgenic OsEATB on rice yield traits.[1].

Gene Symbol

  • Os09g0457900 <=> OsERF#102, OsERF102, AP2/EREBP#123, AP2/EREBP123, OsEATB, EATB

Function

  • Plant height is a decisive factor in plant architecture. Rice (Oryza sativa) plants have the potential for rapid internodal elongation, which determines plant height. A large body of physiological research has shown that ethylene and gibberellin are involved in this process.
  • The APETALA2 (AP2)/Ethylene-Responsive Element Binding Factor (ERF) family of transcriptional factors is only present in the plant kingdom.
  • OsEATB reduces rice plant height and panicle length at maturity, promoting the branching potential of both tillers and spikelets.
  • OsEATB Is a Novel Rice AP2/ERF
  • OsEATB Negatively Regulates Ethylene-Induced Enhancement of GA Responsiveness by Reducing GA Biosynthesis
  • OsEATB Regulates Rice Yield Components through the Promotion of Tillering and Panicle Branching

Phenotypic analysis

  • Overexpression of OsEATB Decreases the Endogenous GA Level in Rice

Expression

  • OsEATB Expression Is Negatively Regulated by Ethylene, ABA, and Abiotic Stress in Rice
  • Ectopic expression of OsEATB showed that the cross talk between ethylene and gibberellin, which is mediated by OsEATB, might underlie differences in rice internode elongation.
  • Analyses of gene expression demonstrated that OsEATB restricts ethylene-induced enhancement of gibberellin responsiveness during the internode elongation process by down-regulating the gibberellin biosynthetic gene, ent-kaurene synthase A.

Labs working on this gene

  • State Key Laboratory of Genetic Engineering, Institute of Genetics, School of Life Sciences, Fudan University,Shanghai 200433, China.
  • Key Laboratory of Analytical Chemistry for Biology and Medicine, Department of Chemistry, Wuhan University, Wuhan 430072, China.

References

  1. 1.0 1.1 1.2 Weiwei Qi, Fan Sun, Qianjie Wang, Mingluan Chen, Yunqing Huang, Yu-Qi Feng, Xiaojin Luo, and Jinshui Yang(2011) Rice Ethylene-Response AP2/ERF Factor OsEATB Restricts Internode Elongation by Down-Regulating a Gibberellin Biosynthetic Gene. Plant Physiol 157:216-228.

Structured Information