Difference between revisions of "Os06g0660200"

From RiceWiki
Jump to: navigation, search
(Expression)
 
(13 intermediate revisions by 5 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os06g0660200''''' was reported as '''''OsPIN2''''' in 2012 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
OsPIN2was proposed as an auxin efflux transporter and a member of the PIN family (Wanget al., 2009)<ref name="pmid:19825657" />. The cDNA
+
* Crop architecture parameters such as tiller number, angle and plant height are important agronomic traits that have been considered for breeding programmes. Auxin distribution within the plant has long been recognized to alter architecture.
sequence of OsPIN2(AK101191) comprises 2276 nucleotides and alignment between the cDNA, and the genomic sequence
+
* '''''OsPIN2''''' has a distinct auxin-dependent regulation pathway together with '''''OsPIN1b''''' and '''''OsTAC1''''' controlling rice shoot architecture.  
revealed that the gene has seven exons and six introns (Figure S1A). The ORF encodes a protein of 629 amino acid
+
* Altering '''''OsPIN2''''' expression by genetic transformation can be directly used for modifying rice architecture.
residues and shows 56.3% sequence identity with Arabidopsis AtPIN2 .Hydropathy and transmembrane (TM) motif
 
analyses of the amino acid sequence revealed that the OsPIN2 protein contains three characteristic regions, including a
 
hydrophobic region with five TM domains, a predominantly hydrophilic core, followed by another hydrophobic region with
 
four TM segments .
 
  
'''The gain of function ofOsPIN2in rice plants'''
+
===Phenotypic analysis===
 
+
* Over-expression of '''''OsPIN2''''' through a transgenic approach in rice (Japonica cv. Nipponbare) led to a shorter plant height, more tillers and a larger tiller angle when compared with wild type (WT).
It was previously reported that knockdown of OsPIN1bexpression very significantly increased the number of tillers and tiller
+
* Over-expression of OsPIN2 enhanced auxin transport from shoots to roots, but did not alter the polar auxin pattern in the roots.  
angle, while over-expression did not alter the shoot architecture
+
* Transgenic plants were less sensitive to N- 1 -naphthylphtha-lamic acid, an auxin transport inhibitor, than WT in their root growth.  
of rice (Xuet al., 2005)<ref name="pmid:16085936" />. In the rice genome, OsLazy1 has been
+
* OsPIN2-over-expressing plants had suppressed the expression of a gravitropism-related gene OsLazy1 in the shoots, but unaltered expression of OsPIN1b and OsTAC1, which were reported as tiller angle controllers in rice.
identified as a novel grass-specific protein playing a negative
 
role in polar auxin transport; its mutation resulted in an increase
 
in the rice tiller angle (Abe et al., 1996<ref name="pmid:11539861" />; Li et al., 2007<ref name="pmid:17468779" />; Yoshihara and Iino, 2007<ref name="pmid:17412736" /> ). It is interesting to speculate whether
 
enhancingOsLazy1expression could compact rice architecture
 
further. In addition, OsTAC1was defined as a tiller angle
 
control gene in rice, its expression level positively correlated
 
with tiller angle and numbers (Yuet al., 2007))<ref name="pmid:17908158" />.
 
Transgenic plants over-expressingOsPIN2showed larger tiller
 
angles, lower plant height, more tillers than WT (Figure 2c–e),
 
which was similar to theOsPIN1bknockdown mutants (Xu
 
et al., 2005)<ref name="pmid:16085936" />. The change of phenotype caused by alteration of
 
OsPIN2andOsPIN1bexpression supported the common observation that rice plant height was negatively correlated with tiller
 
number (Wang and Li, 2005). Therefore, auxin might play a key
 
role in the crosstalk between the plant height and branching,
 
an aspect of canopy architecture which is poorly understood.
 
  
 
===Expression===
 
===Expression===
'''Generation of transgenic rice showingOsPIN2 over-expression and phenotypes of transformants'''
+
* The expression patterns of the auxin reporter DR5::GUS and quantification of auxin distribution showed that '''''OsPIN2''''' over-expression increased auxin transport from the shoot to the root–shoot junction, resulting in a non-tissue-specific accumulation of more free auxin at the root–shoot junction relative to WT.
Ubiquitin promoter (pUbi) has been long reported as a useful
 
strong promoter in a variety of applications in gene transfer
 
studies and drives the gene expression most actively in rapidly
 
dividing cells (Cornejoet al., 1993)<ref name="pmid:8219091" /> . To investigate the function
 
ofOsPIN2in rice, we made transgenic rice plants over-expressing the full length of cDNA driven by pUbi. Southern blotting
 
analysis revealed that they came from two transgenic lines (O1
 
and O2, respectively) distinct from each other and both had
 
one copy of the transgene (Figure 1a). Real-time RT-PCR
 
analyses showed that transcriptional expression ofOsPIN2was
 
moderate in the root–shoot junctions and roots but very faint in
 
the leaves of WT (the untransformed plants as control)
 
(Figure 1b). In both the transgenic lines, OsPIN2had the most
 
abundant transcripts in the root–shoot junction, and similar
 
levels in the leaves and roots (Figure 1b). The increases in
 
OsPIN2transcriptional expression driven by pUbi in these tissues
 
reached by 3–15 times.
 
Over-expression ofOsPIN2significantly increased tiller angle
 
and numbers and decreased height of the rice in comparison
 
with WT (Figure 1i). At 80 days after germination (Figure 1c–j),
 
O1 and O2 plants had a wider tiller angle (the angle between
 
the outermost tillers in the left and right side) (44° and 48°,
 
respectively) than the WT (22°) (Figure 1c). In addition, the two
 
transgenic lines had many more tillers per plant (21 and 23,
 
respectively) than the WT (17 on the average) (Figure 1d). In
 
contrast, the whole plant height was very significantly
 
decreased byOsPIN2over-expression (Figure 1e). The transgenic
 
plant phenotypes were inheritable from T0 (Figure 2f–h) to T2
 
generations (Figure 2i–j).
 
At the ripening stage (Figure 1j), theOsPIN2-over-expressing
 
plants showed shorter panicle length, less number of grains per
 
panicle and lower grain weight per panicle in comparison with
 
the control (Table 1). Even though the seed setting rate was
 
similar between O1, O2 and WT, O1 plants had a 35% increase
 
in the effective tiller number, leading to a 16% grain yield
 
increase per plant relative to control plants (Table 1). O2 plants
 
showed the same tendency but not significant increase in panicle number and grain yield (Table 1). OsPIN2over-expression
 
also decreased the grain length and breadth by 4%–7% and
 
12%–16%, respectively (Table 1). The changes in the grain size
 
lead to 10%–12.5% decreases of 1000-grain weight compared
 
to WT. Moreover, over-expression of the OsPIN2significantly
 
decreased the number of adventitious roots and the total root
 
length by 22%–28% (Table 2).
 
To confirm that the changed phenotype of O1 and O2 was
 
caused by over-expression of OsPIN2in the transgenic plants,
 
we detected the location of one copy T-DNA insertion in these
 
two lines. The T-DNA containing ubi-promoter was inserted in
 
the chromosome 3 and 10 in the genome of O1 and O2,
 
respectively (Figure 2).
 
 
 
[[File:Schematic map of integrated T-DNA insertion site in rice genome.jpg]]
 
 
 
There was no putative gene in the insertion site for both O1 and O2. This direct genetic evidence further supported the OsPIN2 contribution to the altered
 
phenotype of the transgenic rice in Figure 1
 
 
 
[[File:Phenotypes and molecular analyses ofOsPIN2over-expression transgenic plants (O1 and O2) and untranformed wild-type plant (WT).jpg]]
 
 
 
'''Auxin transport altered byOsPIN2over-expression
 
in rice'''
 
To assess whether the over-expression ofOsPIN2affected the
 
free auxin levels, the concentration of endogenous free IAA in
 
various organs of the transgenic and WT plants was quantified
 
by high-performance liquid chromatography (HPLC). In the first
 
and second leaves from the top, O1 and O2 transgenic plants
 
contained free IAA concentrations that were 11%–35% lower
 
than that in the control plants (Figure 3a). In the sheath of the
 
first leaf, the transgenic plants and WT had nearly the same
 
concentration of free IAA, while in the sheath of the second
 
leaf, O1 and O2 plants had 38%–53% lower free IAA concentration than that in WT (Figure 3b). In contrast, in the root–
 
shoot junction (shoot base), the two transgenic lines contained
 
65%–128% more free IAA than that in WT (Figure 3c).
 
To detect the effect ofOsPIN2over-expression on auxin distribution, we separated individual roots into three segments:
 
0–4 cm including the root apex and elongation zones; 4–8 cm,
 
the lateral root area; and 8–12 cm which was adjacent to
 
the root–shoot junction. Both transgenic and WT roots showed
 
the same patterns of free IAA concentration with an abrupt
 
decrease from the tip to the root base (Figure 3d).
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
 
 
==Labs working on this gene==
 
Please input related labs here.
 
  
 
==References==
 
==References==
 
<references>
 
<references>
<ref name="pmid:19825657"> Wang, J.R., Hu, H., Wang, G.H., Li, J., Chen, J.Y. and Wu, P. (2009)
+
* <ref name="ref1"> Chen Y, Fan X, Song W, Zhang Y, Xu G. Over-expression of OsPIN2 leads to
Expression of PIN Genes in Rice (Oryza sativaL.): tissue specificity and
+
increased tiller numbers, angle and shorter plant height through suppression of
regulation by hormones. Mol. Plant, 2, 823–831. </ref>
+
OsLAZY1. Plant Biotechnol J. 2012 Feb;10(2):139-49. doi:
<ref name="pmid:16085936"> Xu, M., Zhu, L., Shou, H.X. and Wu, P. (2005) A PIN1 family gene, OsPIN1,
+
10.1111/j.1467-7652.2011.00637.x. PubMed PMID: 21777365.  
involved in auxin-dependent adventitious root emergence and tillering in
+
</ref>
rice. Plant Cell Physiol.46, 1674–1681. </ref>
 
<ref name="pmid:17908158"> Yu, B., Lin, Z., Li, H., Li, X., Li, J., Wang, Y., Zhang, X., Zhu, Z., Zhai, W.,
 
Wang, X., Xie, D. and Sun, C. (2007) TAC1, a major quantitative trait
 
locus controlling tiller angle in rice. Plant J.52, 891–898.</ref>
 
<ref name="pmid:11539861"> Abe, K., Takahashi, H. and Suge, H. (1996) Lazy gene (la) responsible for
 
both an agravitropism of seedlings and lazy habit of tiller growth in rice
 
(Oryza sativaL).J. Plant. Res.109, 381–386. </ref>
 
<ref name="pmid:17468779"> Li, P., Wang, Y., Qian, Q., Fu, Z., Wang, M., Zeng, D., Li, B., Wang, X. and
 
Li, J. (2007) LAZY1 controls rice shoot gravitropism through regulating
 
polar auxin transport.Cell Res.17, 402–410.</ref>
 
<ref name="pmid:17412736"> Yoshihara, T. and Iino, M. (2007) Identification of the gravitropism-related
 
rice gene LAZY1 and elucidation of LAZY1-dependent and -independent
 
gravity signaling pathways.Plant Cell Physiol.48, 678–688 </ref>
 
<ref name="pmid:8219091"> Cornejo, M.J., Luth, D., Blankenship, K.M., Anderson, O.D. and Blechl, A.E.
 
(1993) Activity of a maize ubiquitin promoter in transgenic rice. Plant Mol.
 
Biol.23, 567–581.</ref>
 
 
 
<ref name="pmid:17412736"> Yoshihara, T. and Iino, M. (2007) Identification of the gravitropism-related
 
rice gene LAZY1 and elucidation of LAZY1-dependent and -independent
 
gravity signaling pathways.Plant Cell Physiol.48, 678–688 </ref>
 
<ref name="pmid:17468779"> Li, P., Wang, Y., Qian, Q., Fu, Z., Wang, M., Zeng, D., Li, B., Wang, X. and
 
Li, J. (2007) LAZY1 controls rice shoot gravitropism through regulating
 
polar auxin transport.Cell Res.17, 402–410.</ref>
 
<ref name="pmid:17412736"> Yoshihara, T. and Iino, M. (2007) Identification of the gravitropism-related
 
rice gene LAZY1 and elucidation of LAZY1-dependent and -independent
 
gravity signaling pathways.Plant Cell Physiol.48, 678–688 </ref>
 
 
 
 
</references>
 
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os06g0660200|
 
Description = Similar to Auxin efflux carrier protein|
 
Version = NM_001064803.1 GI:115469337 GeneID:4341736|
 
Length = 3804 bp|
 
Definition = Oryza sativa Japonica Group Os06g0660200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:28077811..28081614|
 
CDS = 28077886..28078901,28078996..28079180,28079269..28079572,28080611..28080696,28080796..28080953<br>,28081075..28081151,28081241..28081307|
 
GCID = <gbrowseImage1>
 
name=NC_008399:28077811..28081614
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:28077811..28081614
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgatcaccggacgcgacatctacgacgtgctggcggcgatcgtgccgctgtacgtggcgatgttcctggcgtacgggtcggtgcggtggtgggggatattcacgccggaccagtgctccggcatcaaccgcttcgtcgccgtcttcgccgtgccgctcctctccttccacttcatctccaccaacgacccctactccatgaactaccgcttcctcgccgccgactcgctccagaagctcgtcatcctcgccgcgctcgccgtctggcacaacctgctctcccgctaccgccgcaatggcggcgccgccgcgtcgctcgactggaccatcaccctcttctcgctgtccacgctgcccaacacgctggtcatgggcatcccgctgctccgcgccatgtacggcgacttctccggctcgctcatggtgcagatcgtcgtgctccagagcgtcatctggtacaccctcatgctcttcctcttcgagtaccgcggcgccaaggcgctcatctccgagcagttcccgccggacgtcggcgccagcatcgcctcgttccgcgtcgactccgacgtcgtctcgctcaacgggagggaggcgctgcaggcggacgccgaggtggggcgcgacggccgcgtccacgtcgtcatccgccgctccgcctcggcctccaccacgggcggcggcggcggcgcggcgcgctccggcgtgtcccgggcgtacggcgcgtccaacgccatgacgccgcgcgcctccaacctcaccggcgtggagatctactcgctgcagacgtcgcgcgagcccacgccgcgggcgtccagcttcaaccaggccgacttctacgccatgttctccggcagcaagatggccagccagatggctagccccatggcgcagcacggcggcgccggcggccgcgcccagggcctcgacgagcaggtcaccaacaagttcgcctccggcaaggccgccgacccgccgtcgtatcccgccccgaaccccggcatgatgccggcgccaaggaagaaggagctcgggggctcaaactccaactccaacaaggagctacacatgttcgtgtggagctctagcgcgtcgccggtgtcggaggccaacctccgcaacgccgtcaaccacgccgcctccaccgacttcgcctccgcgccgccgccggcagccgttcccgtcggcggcgccactcccaaaggggtgagtggcagtgtcacgccggcggcgaagaacggcggcggcgagttggagatcgaggacgggctgaagagcccggcggcggggctggcggcgaagttcccggtgtcggggtcgccgtacgtggcgccgaggaagaagggcggcggcgccgacgtgcccgggctggcggaggcggcgcacccgatgccgccgacgagcgtgatgacgcggctcatcctcatcatggtgtggcgcaagctcatcagaaaccccaacacctactccagcctcatcggcctcgtctggtccctcgtctccttcaggtggaatatccaaatgccttcaataataaagggctcaatatcaatattgtcagatgcagggctaggaatggctatgttcagcttaggcttgttcatggctctgcaaccaaagatcatttcttgtggcaagaccgttgcgacatttgcaatggcagtgaggttcttgactggtccagctgttattgcagctacttccattgccattgggctcaggggagtactcttgcatgttgccattgttcaggcagcacttccacaaggcattgtcccgtttgtgtttgccaaggagtacaattgccatcctcaaatacttagcacagcggttatttttgggatgctcatcgcgcttccgatcacgatactctactatgtgcttcttgggatatag</cdnaseq>|
 
AA = <aaseq>MITGRDIYDVLAAIVPLYVAMFLAYGSVRWWGIFTPDQCSGINR                    FVAVFAVPLLSFHFISTNDPYSMNYRFLAADSLQKLVILAALAVWHNLLSRYRRNGGA                    AASLDWTITLFSLSTLPNTLVMGIPLLRAMYGDFSGSLMVQIVVLQSVIWYTLMLFLF                    EYRGAKALISEQFPPDVGASIASFRVDSDVVSLNGREALQADAEVGRDGRVHVVIRRS                    ASASTTGGGGGAARSGVSRAYGASNAMTPRASNLTGVEIYSLQTSREPTPRASSFNQA                    DFYAMFSGSKMASQMASPMAQHGGAGGRAQGLDEQVTNKFASGKAADPPSYPAPNPGM                    MPAPRKKELGGSNSNSNKELHMFVWSSSASPVSEANLRNAVNHAASTDFASAPPPAAV                    PVGGATPKGVSGSVTPAAKNGGGELEIEDGLKSPAAGLAAKFPVSGSPYVAPRKKGGG                    ADVPGLAEAAHPMPPTSVMTRLILIMVWRKLIRNPNTYSSLIGLVWSLVSFRWNIQMP                    SIIKGSISILSDAGLGMAMFSLGLFMALQPKIISCGKTVATFAMAVRFLTGPAVIAAT                    SIAIGLRGVLLHVAIVQAALPQGIVPFVFAKEYNCHPQILSTAVIFGMLIALPITILY                    YVLLGI</aaseq>|
 
DNA = <dnaseqindica>76..1091#1186..1370#1459..1762#2801..2886#2986..3143#3265..3341#3431..3497#aattagctcgttctcttgtgtcaagaaaaaaaaagaaagaaaaagctcgccgccgccgccaccgtcgccggcgcgatgatcaccggacgcgacatctacgacgtgctggcggcgatcgtgccgctgtacgtggcgatgttcctggcgtacgggtcggtgcggtggtgggggatattcacgccggaccagtgctccggcatcaaccgcttcgtcgccgtcttcgccgtgccgctcctctccttccacttcatctccaccaacgacccctactccatgaactaccgcttcctcgccgccgactcgctccagaagctcgtcatcctcgccgcgctcgccgtctggcacaacctgctctcccgctaccgccgcaatggcggcgccgccgcgtcgctcgactggaccatcaccctcttctcgctgtccacgctgcccaacacgctggtcatgggcatcccgctgctccgcgccatgtacggcgacttctccggctcgctcatggtgcagatcgtcgtgctccagagcgtcatctggtacaccctcatgctcttcctcttcgagtaccgcggcgccaaggcgctcatctccgagcagttcccgccggacgtcggcgccagcatcgcctcgttccgcgtcgactccgacgtcgtctcgctcaacgggagggaggcgctgcaggcggacgccgaggtggggcgcgacggccgcgtccacgtcgtcatccgccgctccgcctcggcctccaccacgggcggcggcggcggcgcggcgcgctccggcgtgtcccgggcgtacggcgcgtccaacgccatgacgccgcgcgcctccaacctcaccggcgtggagatctactcgctgcagacgtcgcgcgagcccacgccgcgggcgtccagcttcaaccaggccgacttctacgccatgttctccggcagcaagatggccagccagatggctagccccatggcgcagcacggcggcgccggcggccgcgcccagggcctcgacgagcaggtcaccaacaagttcgcctccggcaaggccgccgacccgccgtcgtatcccgccccgaaccccggcatgatgccggcgccaaggtaaaatgaaactgattattaacacctcaaaatttctgttcatcgatcgtgttttgatcgagttggatttttgattttgtcgccattgctacaggaagaaggagctcgggggctcaaactccaactccaacaaggagctacacatgttcgtgtggagctctagcgcgtcgccggtgtcggaggccaacctccgcaacgccgtcaaccacgccgcctccaccgacttcgcctccgcgccgccgccggcagccgttcccgtcggcggcgccactcccaaaggtactctctcatccatccattgacgcacacgacgacgatcacaccacatgtgttcaaggcttcgtctaatggtgcgtgcatgccacaggggtgagtggcagtgtcacgccggcggcgaagaacggcggcggcgagttggagatcgaggacgggctgaagagcccggcggcggggctggcggcgaagttcccggtgtcggggtcgccgtacgtggcgccgaggaagaagggcggcggcgccgacgtgcccgggctggcggaggcggcgcacccgatgccgccgacgagcgtgatgacgcggctcatcctcatcatggtgtggcgcaagctcatcagaaaccccaacacctactccagcctcatcggcctcgtctggtccctcgtctccttcaggtattggattctcaccgatgttttcggtactcaagctgacgttctcgcttccacagttccacttcatcgacgcccgctttcccggtcgcttccctctaagatggaacactcttctgccaatacattttgacatcccacagctatgacagatcgcttatcccggttcatcttcagggcaagggcgctttttttcaagttataccgaattatcaaaacagattatttactctccatttcaaaaaagtattttataaaaaaaaatattcttctactacattacttagattacttgttttaagctagttgttaagtttttttttaaattgtttaatttatttgtataatgaaatcgataatctgcatagtaatctaaaccaaataagtaatatacacttgagttcacgatctgatcaatttatgttgttcgaagctacaaaaaggatatatttttgctatgctattcgttgctagattgcttgaaattttaatctaggaagaggcaagatcgatgagaacttacttaacttcacaactggattagtgttttctgaacgcatgtgagagcacatgataattacgttggtctcggatctggtccagcacatgcaaagaacatacacacgtatgcagatgcaggtgcaggtgcaggtcttatgtgagccctggagtttagcagcagagaccaaatctaccgaatcagctgcgattgccgtgtttgtccccatccaagacagacacggcgaattcggctcaactagctagatgatccatcatgtgtacaagaagaagagcaaaaaatgtacaatgatatggatgcatcattgattcattgtactactatcttaccattagatggcacatctagagggagggttgcaagaacagggcatttttagtggggaggagcacatgcctgcaagcatctaaaattgcatacatgcatgatacatctagcattgattctcttgtcatacaatttttttttacattgtgaaaatatatgcttaattgcttattgactttgtgaatttggatcaggtggaatatccaaatgccttcaataataaagggctcaatatcaatattgtcagatgcagggctaggaatggctatgttcagcttaggtacagagttgacctttttgatacatatctatagccataactagtgagttttttctttgctttgaccaagaaattctgacaatagtatatgtaacccaggcttgttcatggctctgcaaccaaagatcatttcttgtggcaagaccgttgcgacatttgcaatggcagtgaggttcttgactggtccagctgttattgcagctacttccattgccattgggctcaggggagtactcttgcatgttgccattgttcaggtaagcagtagattctttatttcttgcaatcatcttaaaagaaaaaaaatattaaattttgtaattatggtgaattggaatgtattgtggtgatcttatagattaattgattgtcaaacaggcagcacttccacaaggcattgtcccgtttgtgtttgccaaggagtacaattgccatcctcaaatacttagcacagcgtaagaaatgcatgcttaaactttctatttgttcgtccatacggttgctgaagtatatagcctaaaatatataaatgtgaaattttcagggttatttttgggatgctcatcgcgcttccgatcacgatactctactatgtgcttcttgggatatagtgttcttgaagaaggcaaaaaagaaagagtagggaaaaaaataggattctaggtttctagaggaaaatgcaaaagaaatatgatatgggctttcttgaagacctgaagaactaccagagctgaagaatagggaaatgagatcaagtaggatcctagctagagagaaatgcaaaggaaagacaccccttgattacaattttttaattttttctgcaactgttttggcatcaaagtaaaggttagggccttgagtatgaagagttcagccgttaatttgacaagttgggttggcggtactaaagattcc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001064803.1 RefSeq:Os06g0660200]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 15:39, 7 March 2017

The rice Os06g0660200 was reported as OsPIN2 in 2012 [1] by researchers from China.

Annotated Information

Function

  • Crop architecture parameters such as tiller number, angle and plant height are important agronomic traits that have been considered for breeding programmes. Auxin distribution within the plant has long been recognized to alter architecture.
  • OsPIN2 has a distinct auxin-dependent regulation pathway together with OsPIN1b and OsTAC1 controlling rice shoot architecture.
  • Altering OsPIN2 expression by genetic transformation can be directly used for modifying rice architecture.

Phenotypic analysis

  • Over-expression of OsPIN2 through a transgenic approach in rice (Japonica cv. Nipponbare) led to a shorter plant height, more tillers and a larger tiller angle when compared with wild type (WT).
  • Over-expression of OsPIN2 enhanced auxin transport from shoots to roots, but did not alter the polar auxin pattern in the roots.
  • Transgenic plants were less sensitive to N- 1 -naphthylphtha-lamic acid, an auxin transport inhibitor, than WT in their root growth.
  • OsPIN2-over-expressing plants had suppressed the expression of a gravitropism-related gene OsLazy1 in the shoots, but unaltered expression of OsPIN1b and OsTAC1, which were reported as tiller angle controllers in rice.

Expression

  • The expression patterns of the auxin reporter DR5::GUS and quantification of auxin distribution showed that OsPIN2 over-expression increased auxin transport from the shoot to the root–shoot junction, resulting in a non-tissue-specific accumulation of more free auxin at the root–shoot junction relative to WT.

References

  1. Chen Y, Fan X, Song W, Zhang Y, Xu G. Over-expression of OsPIN2 leads to increased tiller numbers, angle and shorter plant height through suppression of OsLAZY1. Plant Biotechnol J. 2012 Feb;10(2):139-49. doi: 10.1111/j.1467-7652.2011.00637.x. PubMed PMID: 21777365.

Structured Information