|
|
| (24 intermediate revisions by 5 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os07g0592600''''' was reported as '''''GH3-8''''' in 2008 <ref name="ref1" /> by researchers from China. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os07g0592600''''' '''''<=>''''' '''''OsGH3-8, OsMGH3, OsGH3.8''''' |
| | + | |
| | ===Function=== | | ===Function=== |
| | + | * The rice '''''GH3-8''''' is an auxin-responsive gene functioning in auxin-dependent development, activates disease resistance in a salicylic acid signaling– and jasmonic acid signaling–independent pathway. |
| | + | * Upregulation of '''''GH3-8'''''Enhances Disease Resistance but Causes Abnormal Morphology |
| | + | * GH3-8 Is an IAA–Amido Synthetase and Modulates Auxin Homeostasis |
| | | | |
| − | OsMGH3 (OsGH3-8) is a member of group II GH3 proteins whose closest Arabidopsis sequence homolog AtGH3.2 functions as a negative component in auxin signaling by regulating auxin level and activity<ref name="ref1" /><ref name="ref2" />
| + | ===Phenotypic analysis=== |
| − | Auxin plays a central role in nearly all aspects of plant growth and development. The final molecular and cellular outcome of auxin signaling in a specific tissue/spatially localized domain depends very critically on the level of its biologically active pool. This is mostly regulated by a homeostasis between its biosynthesis and inactivation. The significance of auxin homeostasis is underscored by the finding that in Arabidopsis_99% of the IAA pool is maintained in the conjugated inactive form generated by various GH3 proteins, and only 1% of IAA occurs as the biologically active form<ref name="ref3" />. Thus, regulated expression of GH3 factors can contribute to auxin signaling and these genes are ideal targets for transcription regulators to execute their developmental functions.
| + | * Overexpression of '''''GH3-8''''' results in enhanced disease resistance to the rice pathogen Xanthomonas oryzae pv oryzae. * This resistance is independent of jasmonic acid and salicylic acid signaling. Overexpression of GH3-8 also causes abnormal plant morphology and retarded growth and development. |
| − | | + | * Both enhanced resistance and abnormal development may be caused by inhibition of the expression of expansins via suppressed auxin signaling. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | The expression domain of OsMGH3 overlaps with that of OsMADS1 at early stages of floret development (figure 1). In florets at later stages of development with differentiating organs, its expression overlaps more with OsMADS6 <ref name="ref4" /><ref name="ref5" /><ref name="ref6" />. | + | * '''''GH3-8''''' Expression Is Regulated by Multiple Factors |
| − | | + | * The function of '''''GH3-8''''' is tissue-specific, growth stage–specific, and signal molecule–regulated. |
| − | ===Evolution===
| |
| − | Please input evolution information here.
| |
| − | | |
| − | You can also add sub-section(s) at will.
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China |
| | | | |
| | ==References== | | ==References== |
| | <references> | | <references> |
| | <ref name="ref1"> | | <ref name="ref1"> |
| − | Takase, T., Nakazawa, M., Ishikawa, A., Kawashima, M., Ichikawa, T., Takahashi, N. et al. (2004) ydk1-D, an auxin-responsive GH3 mutant that is involved in hypocotyl and root elongation. Plant J. 37:471–483.</ref>
| + | Ding X, Cao Y, Huang L, Zhao J, Xu C, Li X, Wang S. Activation of the |
| | + | indole-3-acetic acid-amido synthetase GH3-8 suppresses expansin expression and |
| | + | promotes salicylate- and jasmonate-independent basal immunity in rice. Plant |
| | + | Cell. 2008 Jan;20(1):228-40. doi: 10.1105/tpc.107.055657. PubMed PMID: 18192436; |
| | + | PubMed Central PMCID: PMC2254934. |
| | + | </ref> |
| | | | |
| − | <ref name="ref2" />
| |
| − | Staswick, P.E., Serban, B., Rowe, M., Tiryaki, I., Maldonado, M.T., Maldonado, M.C. et al. (2005) Characterization of an Arabidopsis enzyme family that conjugates amino acids to indole-3-acetic acid. Plant Cell 17: 616–627.
| |
| − | <ref name="ref3" />
| |
| − | Woodward, C., Bemis, S.M., Hill, E.J., Sawa, S., Koshiba, T. and Torii, K.U. (2005) Interaction of auxin and ERECTA in elaborating Arabidopsis inflorescence architecture revealed by the activation tagging of a new member of the YUCCA family putative flavin monooxygenases. Plant Physiol. 139: 192–203.
| |
| − | <ref name="ref4" />
| |
| − | Prasad, K., Parameswaran, S. and Vijayraghavan, U. (2005) OsMADS1, a rice MADS-box factor, controls differentiation of specific cell types in the lemma and palea and is an early-acting regulator of inner floral organs. Plant J. 43: 915–928.
| |
| − | <ref name="ref5" />
| |
| | </references> | | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os07g0592600|
| |
| − | Description = Similar to Indole-3-acetic acid-amido synthetase GH3.3 (EC 6.3.2.-) (Auxin- responsive GH3-like protein 3) (AtGH3-3)|
| |
| − | Version = NM_001066698.1 GI:115473128 GeneID:4343785|
| |
| − | Length = 2357 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os07g0592600, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
| |
| − | AP = Chromosome 7:24809875..24812231|
| |
| − | CDS = 24810162..24811536,24811631..24812073|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008400:24809875..24812231
| |
| − | source=RiceChromosome07
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008400:24809875..24812231
| |
| − | source=RiceChromosome07
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcggtgatgactgatgtgtcgaccaccgggacggcactccggaccccggcggcgggggcggtgaaggagggcgacgtcgagaagctccggttcatcgacgagatgaccaccaacgtcgacgccgtgcaggagcgcgtcctgggggagatcctcggccgcaacgccggcacggagtacctgaccaagtgcggcctcgacggcgccaccgaccgcgccgccttccgggccaaggttccggtggtgtcgtacgacgacctgcagccgtacatccagcgcattgcgaacggggaccgctcgccgatcctgtccacccaccccgtctccgagttcctcaccagctccggcacgtcggccggcgagcgcaagctgatgcccaccatcatggacgagctcgaccgccgtcagctgctctacagcctcctcatgccggtcatgaacttgtatgtgcctgggcttgacaaggggaaggggctctacttcctgttcgtcaagtcggagacgaagacgccgggaggcctgacggcgaggcccgtgctgacgagctactacaagagcgaccacttcaagaaccggccgtacgacccgtaccacaactacacgagcccgacggcggccatcctctgcgccgacgcgttccagagcatgtacgcgcagatggtgtgcggcctgtgccagcgcaacgacgtgctgcgcctcggcgccgtgttcgcctccggcctcctccgggccatccgcttcctccagctcaactgggagcagctcgccgacgacatcgagtccggcgagctcacccctcgcgtcaccgacccgtcggtgcgcgaggctgtcgccgccatcctcctcccggaccccgagctcgccaagctcatccgcgccgagtgctccaagggcgactgggccggcatcatcacccgcgtgtggccgaacaccaagtacctcgacgtcatcgtcaccggcgcgatggcgcagtacatcccgaccctggagttctacagcggcgggcttcccatggcgtgcaccatgtacgcgtcatccgagtgctacttcggcctcaacctccgccccatgtgcgacccctccgaggtgtcctacaccatcatgcctaacatgggctacttcgagttcctccccgtggacgagaccggcgcggcttcgggcgacgccacccagctcgtggacctcgcccgcgtggaggtggggcgcgagtacgagctggtgatcaccacctacgccgggctgaaccggtaccgcgtcggcgacgtcctccgcgtgacggggttccacaacgcggcgccgcagttcaggttcgtgcgccgcaagaacgtgctcctctccatcgagtccgacaagaccgacgaggccgagctgcagcgcgccgtggagcgcgcgtcggcgctgctccgcccgcacggcgcgtccgtggtggagtacaccagccaagcgtgcaccaagcgcatcccgggccactacgtcatctactgggagctcctgaccaagggcgccggcgccacggtggtggacgcggacacgctgggcaggtgctgcctcgagatggaggaggcgctgaacacggtgtacaggcagagccgcgtcgcggacggctcgattgggccgctcgagatccgggtcgtccgcccgggcacattcgaggagctcatggactacgccatctcccgcggcgcgtccatcaaccagtacaaggtgccacgctgcgtcacgttcccgcccatcgtcgagctgctcgactcgcgcgtcgtgtccagccacttcagcccggcgctcccacactggactccggcgcgacggtccgaatag</cdnaseq>|
| |
| − | AA = <aaseq>MAVMTDVSTTGTALRTPAAGAVKEGDVEKLRFIDEMTTNVDAVQ ERVLGEILGRNAGTEYLTKCGLDGATDRAAFRAKVPVVSYDDLQPYIQRIANGDRSPI LSTHPVSEFLTSSGTSAGERKLMPTIMDELDRRQLLYSLLMPVMNLYVPGLDKGKGLY FLFVKSETKTPGGLTARPVLTSYYKSDHFKNRPYDPYHNYTSPTAAILCADAFQSMYA QMVCGLCQRNDVLRLGAVFASGLLRAIRFLQLNWEQLADDIESGELTPRVTDPSVREA VAAILLPDPELAKLIRAECSKGDWAGIITRVWPNTKYLDVIVTGAMAQYIPTLEFYSG GLPMACTMYASSECYFGLNLRPMCDPSEVSYTIMPNMGYFEFLPVDETGAASGDATQL VDLARVEVGREYELVITTYAGLNRYRVGDVLRVTGFHNAAPQFRFVRRKNVLLSIESD KTDEAELQRAVERASALLRPHGASVVEYTSQACTKRIPGHYVIYWELLTKGAGATVVD ADTLGRCCLEMEEALNTVYRQSRVADGSIGPLEIRVVRPGTFEELMDYAISRGASINQ YKVPRCVTFPPIVELLDSRVVSSHFSPALPHWTPARRSE</aaseq>|
| |
| − | DNA = <dnaseqindica>696..2070#159..601#aggccacacaccaccaacacaaaacatttccttgtccctcgccttcctcgcctcgcctcggctctcacacgacgcctcttcctctcgctactactagctcaagctaagctagcaagagcattccttgggctttttttcttgttcggggttgagaggcaatggcggtgatgactgatgtgtcgaccaccgggacggcactccggaccccggcggcgggggcggtgaaggagggcgacgtcgagaagctccggttcatcgacgagatgaccaccaacgtcgacgccgtgcaggagcgcgtcctgggggagatcctcggccgcaacgccggcacggagtacctgaccaagtgcggcctcgacggcgccaccgaccgcgccgccttccgggccaaggttccggtggtgtcgtacgacgacctgcagccgtacatccagcgcattgcgaacggggaccgctcgccgatcctgtccacccaccccgtctccgagttcctcaccagctccggcacgtcggccggcgagcgcaagctgatgcccaccatcatggacgagctcgaccgccgtcagctgctctacagcctcctcatgccggtcatgaacttgtaagttgatactactcctatcattgtctcattctgatagcacacacacgtacaagaagcagatgatgattaatggccatgaatcattgcataggtatgtgcctgggcttgacaaggggaaggggctctacttcctgttcgtcaagtcggagacgaagacgccgggaggcctgacggcgaggcccgtgctgacgagctactacaagagcgaccacttcaagaaccggccgtacgacccgtaccacaactacacgagcccgacggcggccatcctctgcgccgacgcgttccagagcatgtacgcgcagatggtgtgcggcctgtgccagcgcaacgacgtgctgcgcctcggcgccgtgttcgcctccggcctcctccgggccatccgcttcctccagctcaactgggagcagctcgccgacgacatcgagtccggcgagctcacccctcgcgtcaccgacccgtcggtgcgcgaggctgtcgccgccatcctcctcccggaccccgagctcgccaagctcatccgcgccgagtgctccaagggcgactgggccggcatcatcacccgcgtgtggccgaacaccaagtacctcgacgtcatcgtcaccggcgcgatggcgcagtacatcccgaccctggagttctacagcggcgggcttcccatggcgtgcaccatgtacgcgtcatccgagtgctacttcggcctcaacctccgccccatgtgcgacccctccgaggtgtcctacaccatcatgcctaacatgggctacttcgagttcctccccgtggacgagaccggcgcggcttcgggcgacgccacccagctcgtggacctcgcccgcgtggaggtggggcgcgagtacgagctggtgatcaccacctacgccgggctgaaccggtaccgcgtcggcgacgtcctccgcgtgacggggttccacaacgcggcgccgcagttcaggttcgtgcgccgcaagaacgtgctcctctccatcgagtccgacaagaccgacgaggccgagctgcagcgcgccgtggagcgcgcgtcggcgctgctccgcccgcacggcgcgtccgtggtggagtacaccagccaagcgtgcaccaagcgcatcccgggccactacgtcatctactgggagctcctgaccaagggcgccggcgccacggtggtggacgcggacacgctgggcaggtgctgcctcgagatggaggaggcgctgaacacggtgtacaggcagagccgcgtcgcggacggctcgattgggccgctcgagatccgggtcgtccgcccgggcacattcgaggagctcatggactacgccatctcccgcggcgcgtccatcaaccagtacaaggtgccacgctgcgtcacgttcccgcccatcgtcgagctgctcgactcgcgcgtcgtgtccagccacttcagcccggcgctcccacactggactccggcgcgacggtccgaatagtcggtcaaatccccacctcgtcgttggaccgtgtccaagaatctgaagtagtagaagccggatgcctccacctaaaaacacttatctgttatttttggaattaattttgatggttgctgtcaactctgtcagttagtggcaagagggtacctctgatgtgagggagagaactgcagaacgaacggaagaaagtgttgatgtaagaggttaccactagtagtactgtttgtctgtatcaggaatgtgattataatttaacctgtcctccaaaaccgtacgagtcctgc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066698.1 RefSeq:Os07g0592600]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
