Difference between revisions of "Os07g0592600"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Labs working on this gene)
 
(4 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os07g0592600''''' was reported as '''''GH3-8''''' in 2008 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os07g0592600''''' '''''<=>''''' '''''OsGH3-8, OsMGH3, OsGH3.8'''''
 +
 
===Function===
 
===Function===
 +
* The rice '''''GH3-8''''' is an auxin-responsive gene functioning in auxin-dependent development, activates disease resistance in a salicylic acid signaling– and jasmonic acid signaling–independent pathway.
 +
* Upregulation of '''''GH3-8'''''Enhances Disease Resistance but Causes Abnormal Morphology
 +
* GH3-8 Is an IAA–Amido Synthetase and Modulates Auxin Homeostasis
  
OsMGH3 (OsGH3-8) is a member of group II GH3 proteins whose closest Arabidopsis sequence homolog AtGH3.2 functions as a negative component in auxin signaling by regulating auxin level and activity<ref name="ref1" /><ref name="ref2" />
+
===Phenotypic analysis===
Auxin plays a central role in nearly all aspects of plant growth and development. The final molecular and cellular outcome of auxin signaling in a specific tissue/spatially localized domain depends very critically on the level of its biologically active pool. This is mostly regulated by a homeostasis between its biosynthesis and inactivation. The significance of auxin homeostasis is underscored by the finding that in Arabidopsis_99% of the IAA pool is maintained in the conjugated inactive form generated by various GH3 proteins, and only 1% of IAA occurs as the biologically active form<ref name="ref3" />. Thus, regulated expression of GH3 factors can contribute to auxin signaling and these genes are ideal targets for transcription regulators to execute their developmental functions.
+
* Overexpression of '''''GH3-8''''' results in enhanced disease resistance to the rice pathogen Xanthomonas oryzae pv oryzae. * This resistance is independent of jasmonic acid and salicylic acid signaling. Overexpression of GH3-8 also causes abnormal plant morphology and retarded growth and development.
 
+
* Both enhanced resistance and abnormal development may be caused by inhibition of the expression of expansins via suppressed auxin signaling.
  
 
===Expression===
 
===Expression===
Rice GH3 genes are expressed at varying levels in various wild-type tissues and organs, with the transcript levels for OsGH3-1, 2, 3, 4, 5, 7, 8 and 11 being the highest in flowers (Jain et al. 2006a). The expression of six GH3 genes is de-regulated in OsMADS1 mutant panicles as seen in our analysis of transcript levels using whole-genome microarrays (Prasad et al. 2005, S. R. Yadav, I. Khanday and U. Vijayraghavan, unpublished data). OsMGH3 (OsGH3-8) is a member of group II GH3 proteins whose closest Arabidopsis sequence homolog AtGH3.2 functions as a negative component in auxin signaling by regulating auxin level and activity (Takase et al. 2004, Staswick et al. 2005). OsMGH3/OsGH3-8 (hence forth referred to as OsMGH3) is one amongst this family of genes whose expression is reduced in dsRNAi (double-stranded RNA interference) OsMADS1 panicles and in osmads6 mutant flowers (Prasad et al. 2005, Zhang et al. 2010).The expression domain of OsMGH3 overlaps with that of OsMADS1 at early stages of floret development (figure 1). In florets at later stages of development with differentiating organs, its expression overlaps more with OsMADS6 <ref name="ref4" /><ref name="ref5" /><ref name="ref6" />.
+
* '''''GH3-8''''' Expression Is Regulated by Multiple Factors
 
+
* The function of '''''GH3-8''''' is tissue-specific, growth stage–specific, and signal molecule–regulated.
[[File:Figure 1 In situ RNA expression patterns of OsMADS1 compared with OsMGH3. (a–f) OsMADS1 profile in developing inflorescence branch primordia and spikelets. Silver grains reveal regions with expression.jpg ]]
 
 
 
'''Figure 1 In situ RNA expression patterns of OsMADS1 compared with OsMGH3. (a–f) OsMADS1 profile in developing inflorescence branch primordia and spikelets. Silver grains reveal regions with expression.'''
 
(a) Sense OsMADS1 RNA probe as a control. (b–f) Hybridizations with antisense RNA probes. (b) No transcripts in the very young branching panicle. (c) Near-uniform early expression in the incipient floret meristem. Expression is excluded from the glume primordia (green arrows). Red arrow indicates the future carpel anlagen. (d) Spikelet during an early stage of organ differentiation with OsMADS1 expression in the developing lemma (le)/palea (pa) and weak expression in the carpel (ca). (e, f) Spikelets showing expression in differentiated lemma (le), palea (pa) and carpels (ca). No expression in lodicules (lo) and glumes (gl). (g–l) Non-radioactive RNA in situ analysis of OsMGH3 RNAs in panicles and florets at stages similar to that shown for OsMADS1. (g) No OsMGH3 transcripts in the vegetative SAM (red arrow) or (h) branching panicles (black arrows). (i) Uniform RNA distribution in young spikelet primordia similar to OsMADS1 (compare c, i). Green arrow points to the glume, red arrows to the emerging lemma and palea and the blue arrow indicates the carpel anlagen. (j) Spikelet during organ emergence. OsMGH3 profile begins to deviates from OsMADS1. (k,l) Spikelets with differentiated organs. Greatly reduced expression in the near mature lemma (le) and palea (pa); continued lack of expression in the glumes (gl). Expression is maintained in the lodicules (lo), stamens (st) and carpel (ca). Scale bar is 100 lm in all panels.
 
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
[[File:Figure 2 dyf.jpg]]
 
 
 
'''Figure 2 Phylogenetic analysis and gene structure of apple GH3 members.'''
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
 
+
* National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China
1 Wang Shiping, National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural
 
University, Wuhan 430070, China.
 
 
 
2 Usha Vijayraghavan, Department of Microbiology and Cell Biology, Indian Institute of Science, Bangalore-560012, India.
 
  
 
==References==
 
==References==
 
<references>
 
<references>
 
<ref name="ref1">  
 
<ref name="ref1">  
Takase, T., Nakazawa, M., Ishikawa, A., Kawashima, M., Ichikawa, T., Takahashi, N. et al. (2004) ydk1-D, an auxin-responsive GH3 mutant that is involved in hypocotyl and root elongation. Plant J. 37:471–483.</ref>
+
Ding X, Cao Y, Huang L, Zhao J, Xu C, Li X, Wang S. Activation of the
 
+
indole-3-acetic acid-amido synthetase GH3-8 suppresses expansin expression and
<ref name="ref2">
+
promotes salicylate- and jasmonate-independent basal immunity in rice. Plant
Staswick, P.E., Serban, B., Rowe, M., Tiryaki, I., Maldonado, M.T., Maldonado, M.C. et al. (2005) Characterization of an Arabidopsis enzyme family that conjugates amino acids to indole-3-acetic acid. Plant Cell 17: 616–627.</ref>  
+
Cell. 2008 Jan;20(1):228-40. doi: 10.1105/tpc.107.055657. PubMed PMID: 18192436;
 +
PubMed Central PMCID: PMC2254934.
 +
</ref>
  
<ref name="ref3">
 
Woodward, C., Bemis, S.M., Hill, E.J., Sawa, S., Koshiba, T. and Torii, K.U. (2005) Interaction of auxin and ERECTA in elaborating Arabidopsis inflorescence architecture revealed by the activation tagging of a new member of the YUCCA family putative flavin monooxygenases. Plant Physiol. 139: 192–203.</ref>
 
<ref name="ref4">
 
Prasad, K., Parameswaran, S. and Vijayraghavan, U. (2005) OsMADS1, a rice MADS-box factor, controls differentiation of specific cell types in the lemma and palea and is an early-acting regulator of inner floral organs. Plant J. 43: 915–928.</ref>
 
<ref name="ref5">
 
Li, H., Liang, W., Jia, R., Yin, C., Zong, J., Kong, H. et al. (2010) The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice. Cell Res. 20: 299–313. </ref>
 
<ref name="ref6">
 
Zhang, J., Nallamilli, B.R., Mujahid, H. and Peng, Z. (2010) OsMADS6 plays an essential role in endosperm nutrient accumulation and is subject to epigenetic regulation in rice (Oryza sativa). Plant J. 64:604–617. </ref>
 
 
</references>
 
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os07g0592600|
 
Description = Similar to Indole-3-acetic acid-amido synthetase GH3.3 (EC 6.3.2.-) (Auxin- responsive GH3-like protein 3) (AtGH3-3)|
 
Version = NM_001066698.1 GI:115473128 GeneID:4343785|
 
Length = 2357 bp|
 
Definition = Oryza sativa Japonica Group Os07g0592600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
 
AP = Chromosome 7:24809875..24812231|
 
CDS = 24810162..24811536,24811631..24812073|
 
GCID = <gbrowseImage1>
 
name=NC_008400:24809875..24812231
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008400:24809875..24812231
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcggtgatgactgatgtgtcgaccaccgggacggcactccggaccccggcggcgggggcggtgaaggagggcgacgtcgagaagctccggttcatcgacgagatgaccaccaacgtcgacgccgtgcaggagcgcgtcctgggggagatcctcggccgcaacgccggcacggagtacctgaccaagtgcggcctcgacggcgccaccgaccgcgccgccttccgggccaaggttccggtggtgtcgtacgacgacctgcagccgtacatccagcgcattgcgaacggggaccgctcgccgatcctgtccacccaccccgtctccgagttcctcaccagctccggcacgtcggccggcgagcgcaagctgatgcccaccatcatggacgagctcgaccgccgtcagctgctctacagcctcctcatgccggtcatgaacttgtatgtgcctgggcttgacaaggggaaggggctctacttcctgttcgtcaagtcggagacgaagacgccgggaggcctgacggcgaggcccgtgctgacgagctactacaagagcgaccacttcaagaaccggccgtacgacccgtaccacaactacacgagcccgacggcggccatcctctgcgccgacgcgttccagagcatgtacgcgcagatggtgtgcggcctgtgccagcgcaacgacgtgctgcgcctcggcgccgtgttcgcctccggcctcctccgggccatccgcttcctccagctcaactgggagcagctcgccgacgacatcgagtccggcgagctcacccctcgcgtcaccgacccgtcggtgcgcgaggctgtcgccgccatcctcctcccggaccccgagctcgccaagctcatccgcgccgagtgctccaagggcgactgggccggcatcatcacccgcgtgtggccgaacaccaagtacctcgacgtcatcgtcaccggcgcgatggcgcagtacatcccgaccctggagttctacagcggcgggcttcccatggcgtgcaccatgtacgcgtcatccgagtgctacttcggcctcaacctccgccccatgtgcgacccctccgaggtgtcctacaccatcatgcctaacatgggctacttcgagttcctccccgtggacgagaccggcgcggcttcgggcgacgccacccagctcgtggacctcgcccgcgtggaggtggggcgcgagtacgagctggtgatcaccacctacgccgggctgaaccggtaccgcgtcggcgacgtcctccgcgtgacggggttccacaacgcggcgccgcagttcaggttcgtgcgccgcaagaacgtgctcctctccatcgagtccgacaagaccgacgaggccgagctgcagcgcgccgtggagcgcgcgtcggcgctgctccgcccgcacggcgcgtccgtggtggagtacaccagccaagcgtgcaccaagcgcatcccgggccactacgtcatctactgggagctcctgaccaagggcgccggcgccacggtggtggacgcggacacgctgggcaggtgctgcctcgagatggaggaggcgctgaacacggtgtacaggcagagccgcgtcgcggacggctcgattgggccgctcgagatccgggtcgtccgcccgggcacattcgaggagctcatggactacgccatctcccgcggcgcgtccatcaaccagtacaaggtgccacgctgcgtcacgttcccgcccatcgtcgagctgctcgactcgcgcgtcgtgtccagccacttcagcccggcgctcccacactggactccggcgcgacggtccgaatag</cdnaseq>|
 
AA = <aaseq>MAVMTDVSTTGTALRTPAAGAVKEGDVEKLRFIDEMTTNVDAVQ                    ERVLGEILGRNAGTEYLTKCGLDGATDRAAFRAKVPVVSYDDLQPYIQRIANGDRSPI                    LSTHPVSEFLTSSGTSAGERKLMPTIMDELDRRQLLYSLLMPVMNLYVPGLDKGKGLY                    FLFVKSETKTPGGLTARPVLTSYYKSDHFKNRPYDPYHNYTSPTAAILCADAFQSMYA                    QMVCGLCQRNDVLRLGAVFASGLLRAIRFLQLNWEQLADDIESGELTPRVTDPSVREA                    VAAILLPDPELAKLIRAECSKGDWAGIITRVWPNTKYLDVIVTGAMAQYIPTLEFYSG                    GLPMACTMYASSECYFGLNLRPMCDPSEVSYTIMPNMGYFEFLPVDETGAASGDATQL                    VDLARVEVGREYELVITTYAGLNRYRVGDVLRVTGFHNAAPQFRFVRRKNVLLSIESD                    KTDEAELQRAVERASALLRPHGASVVEYTSQACTKRIPGHYVIYWELLTKGAGATVVD                    ADTLGRCCLEMEEALNTVYRQSRVADGSIGPLEIRVVRPGTFEELMDYAISRGASINQ                    YKVPRCVTFPPIVELLDSRVVSSHFSPALPHWTPARRSE</aaseq>|
 
DNA = <dnaseqindica>696..2070#159..601#aggccacacaccaccaacacaaaacatttccttgtccctcgccttcctcgcctcgcctcggctctcacacgacgcctcttcctctcgctactactagctcaagctaagctagcaagagcattccttgggctttttttcttgttcggggttgagaggcaatggcggtgatgactgatgtgtcgaccaccgggacggcactccggaccccggcggcgggggcggtgaaggagggcgacgtcgagaagctccggttcatcgacgagatgaccaccaacgtcgacgccgtgcaggagcgcgtcctgggggagatcctcggccgcaacgccggcacggagtacctgaccaagtgcggcctcgacggcgccaccgaccgcgccgccttccgggccaaggttccggtggtgtcgtacgacgacctgcagccgtacatccagcgcattgcgaacggggaccgctcgccgatcctgtccacccaccccgtctccgagttcctcaccagctccggcacgtcggccggcgagcgcaagctgatgcccaccatcatggacgagctcgaccgccgtcagctgctctacagcctcctcatgccggtcatgaacttgtaagttgatactactcctatcattgtctcattctgatagcacacacacgtacaagaagcagatgatgattaatggccatgaatcattgcataggtatgtgcctgggcttgacaaggggaaggggctctacttcctgttcgtcaagtcggagacgaagacgccgggaggcctgacggcgaggcccgtgctgacgagctactacaagagcgaccacttcaagaaccggccgtacgacccgtaccacaactacacgagcccgacggcggccatcctctgcgccgacgcgttccagagcatgtacgcgcagatggtgtgcggcctgtgccagcgcaacgacgtgctgcgcctcggcgccgtgttcgcctccggcctcctccgggccatccgcttcctccagctcaactgggagcagctcgccgacgacatcgagtccggcgagctcacccctcgcgtcaccgacccgtcggtgcgcgaggctgtcgccgccatcctcctcccggaccccgagctcgccaagctcatccgcgccgagtgctccaagggcgactgggccggcatcatcacccgcgtgtggccgaacaccaagtacctcgacgtcatcgtcaccggcgcgatggcgcagtacatcccgaccctggagttctacagcggcgggcttcccatggcgtgcaccatgtacgcgtcatccgagtgctacttcggcctcaacctccgccccatgtgcgacccctccgaggtgtcctacaccatcatgcctaacatgggctacttcgagttcctccccgtggacgagaccggcgcggcttcgggcgacgccacccagctcgtggacctcgcccgcgtggaggtggggcgcgagtacgagctggtgatcaccacctacgccgggctgaaccggtaccgcgtcggcgacgtcctccgcgtgacggggttccacaacgcggcgccgcagttcaggttcgtgcgccgcaagaacgtgctcctctccatcgagtccgacaagaccgacgaggccgagctgcagcgcgccgtggagcgcgcgtcggcgctgctccgcccgcacggcgcgtccgtggtggagtacaccagccaagcgtgcaccaagcgcatcccgggccactacgtcatctactgggagctcctgaccaagggcgccggcgccacggtggtggacgcggacacgctgggcaggtgctgcctcgagatggaggaggcgctgaacacggtgtacaggcagagccgcgtcgcggacggctcgattgggccgctcgagatccgggtcgtccgcccgggcacattcgaggagctcatggactacgccatctcccgcggcgcgtccatcaaccagtacaaggtgccacgctgcgtcacgttcccgcccatcgtcgagctgctcgactcgcgcgtcgtgtccagccacttcagcccggcgctcccacactggactccggcgcgacggtccgaatagtcggtcaaatccccacctcgtcgttggaccgtgtccaagaatctgaagtagtagaagccggatgcctccacctaaaaacacttatctgttatttttggaattaattttgatggttgctgtcaactctgtcagttagtggcaagagggtacctctgatgtgagggagagaactgcagaacgaacggaagaaagtgttgatgtaagaggttaccactagtagtactgtttgtctgtatcaggaatgtgattataatttaacctgtcctccaaaaccgtacgagtcctgc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066698.1 RefSeq:Os07g0592600]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 01:46, 8 March 2017

The rice Os07g0592600 was reported as GH3-8 in 2008 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os07g0592600 <=> OsGH3-8, OsMGH3, OsGH3.8

Function

  • The rice GH3-8 is an auxin-responsive gene functioning in auxin-dependent development, activates disease resistance in a salicylic acid signaling– and jasmonic acid signaling–independent pathway.
  • Upregulation of GH3-8Enhances Disease Resistance but Causes Abnormal Morphology
  • GH3-8 Is an IAA–Amido Synthetase and Modulates Auxin Homeostasis

Phenotypic analysis

  • Overexpression of GH3-8 results in enhanced disease resistance to the rice pathogen Xanthomonas oryzae pv oryzae. * This resistance is independent of jasmonic acid and salicylic acid signaling. Overexpression of GH3-8 also causes abnormal plant morphology and retarded growth and development.
  • Both enhanced resistance and abnormal development may be caused by inhibition of the expression of expansins via suppressed auxin signaling.

Expression

  • GH3-8 Expression Is Regulated by Multiple Factors
  • The function of GH3-8 is tissue-specific, growth stage–specific, and signal molecule–regulated.

Labs working on this gene

  • National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China

References

  1. Ding X, Cao Y, Huang L, Zhao J, Xu C, Li X, Wang S. Activation of the indole-3-acetic acid-amido synthetase GH3-8 suppresses expansin expression and promotes salicylate- and jasmonate-independent basal immunity in rice. Plant Cell. 2008 Jan;20(1):228-40. doi: 10.1105/tpc.107.055657. PubMed PMID: 18192436; PubMed Central PMCID: PMC2254934.

Structured Information