|
|
| (22 intermediate revisions by 3 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os07g0605200''''' was reported as '''''OsMADS18''''' in 2004 <ref name="ref1" /> by researchers from Italy. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| − | ===Function=== | + | [[File:308-Os07g0605200.png|right|thumb|327px|'''Figure 7.''' ''OsMADS18 overexpression in Arabidopsis.<ref name="ref1" />.'']] |
| − | Please input function information here.
| |
| | | | |
| − | OsMADS18 from rice (Oryza sativa) belongs to the phylogenetically defined AP1/SQUA group. The MADS box genes of this group have functions in plant development, like controlling the transition from vegetative to reproductive growth, determination of floral organ identity, and regulation of fruit maturation. | + | ===Gene Symbol=== |
| | + | *'''''Os07g0605200''''' '''''<=>''''' '''''OsMADS18, MADS2, OsMADS2, MADS28, OsMADS28, FDRMADS7, OsMADS18/28''''' |
| | | | |
| − | RNAi-Mediated Silencing of OsMADS18
| + | ===Function=== |
| − | | + | * '''''MADS box''''' transcription factors controlling flower development have been isolated and studied in a wide variety of organisms. |
| − | We used an RNAi-based approach to silence OsMADS18 in rice. A specific portion of the OsMADS18 cDNA, lacking the highly conserved MADS box and part of the I region, was cloned in antisense and sense orientation in an RNAi expression cassette, under the control of the cauliflower mosaic virus (CaMV) 35S promoter. The construct was transformed into rice by Agrobacterium-mediated transformation. A total of 31 independent hygromycin-resistant calli were obtained. For each of these calli one regenerated plant was analyzed in detail. The RNAi approach proved to be very efficient in silencing OsMADS18 since 60% of the lines showed reduction of transcript levels to various degrees (Fig. 4). For more than 80% of these lines OsMADS18 mRNAs could not be detected by northern-blot analysis while the remaining 20% still expressed OsMADS18, although very weakly. Both the 31 T0 plants and the T1 progeny of 10 selected transformants were normal in development. No visible alterations were observed in panicleand flower morphology. Furthermore, we analyzed these plants for differences in flowering time under inductive short day (12 h light/12 h dark) and non-inductive long day (16 h light/8 h dark) conditions.This analysis showed that the flowering time of the RNAi plants is comparable to wild-type plants (data not shown). These observations suggest that other genes are possibly redundant with OsMADS18. Possible candidates for such a role, as inferred from phylogenetic analysis, are OsMADS14, OsMADS15,and/or OsMADS20 (Lee et al., 2003).
| + | * Homologous '''''MADS box''''' genes from different species often have similar functions. |
| − | | + | * '''''OsMADS18''''' is an AP1/SQUA-Like MADS Box Gene |
| − | Overexpression of OsMADS18 in Rice
| + | * Expression of '''''OsMADS18''''' in Arabidopsis Causes an ap1 Mutant Phenotype |
| | + | * '''''OsMADS18''''' Interacts with SEP Proteins from Arabidopsis |
| | + | * Functional Analysis of '''''OsMADS18''''' Reveals a Role in the Promotion of Flowering in Rice. |
| | + | * As '''''OsMADS18'''' is able to interact with at least a subset of the AP1 partners in yeast we demonstrated that AP1 can, vice versa, interact with '''''OsMADS18'''' and '''''OsMADS18'''' but not with OsMADS6. |
| | | | |
| − | To address the function of OsMADS18 in rice,we constructed an overexpression cassette, fusing the OsMADS18 coding sequence with the strong CaMV35S promoter. Twenty-seven independent transgenic lines that overexpressed the transgene at different levels were identified (data not shown). Four of these plants that showed the highest levels of OsMADS18 expression remained very small in size and flowered at 105 d after germination compared to wild-type plants which flower at 140 d after germination(Fig. 5A). Two of them (501S and 1102S) were selected for further studies. Expression analysis of progeny plants of line 501S and 1102S demonstrated that OsMADS18 overexpression segregated with the early flowering phenotype (data not shown).In order to test whether OsMADS18 overexpression affected only the transition to flowering or had a broader effect on rice development, we carried out a detailed morphological analysis on plants,ranging from 0 to 30 d after germination (Fig. 5D). The first effects can already be observed 5 d after germination (Fig. 5, B and C). At this time leaves of transgenic plants are still enclosed by the coleoptile, while wild-type leaves are already emerging from it. After 7 d from germination wild-type plants are about 12 mm long while the transgenic 501S and 1102S plants are 5.5 mm on average (Fig. 5D). Lines 501S and 1102S stay smaller than wild-type plants and this effect is due to a lower rate of internode elongation (Fig. 6, D–G) and a reduction in the length of the leaf sheath. Despite this difference, leaf number is comparable between wild-type and transgenic lines. Regardless of this deficiency in elongation ability, mutant lines form axillary meristems earlier than wild-type plants. These axillary buds are visible in lines overexpressing OsMADS18 after 7 d from germination (Fig. 6, A and B), whereas in wild-type plants these buds develop only after 15d, from germination (Fig. 6C and Supplemental Fig. 1, available at www.plantphysiol.org). Furthermore, in the leaves of the transgenic plants the aerenchyma differentiates earlier than in wild-type plants and the aerenchyma cavities are larger (Fig. 6, A and B). We also monitored the effects on root development in the transgenic lines 501S and 1102S. Microscopic analysis revealed that the adventitious root primordia develop at the same time as in wild-type plants although their number was reduced in these transgenic lines. Furthermore, at early stages the adventitious root elongation in lines 501S and 1102S is slower compared to wild-type plants (Fig. 5D; Supplemental Table I). The differences between wild-type and transgenic lines are more evident shortly after germination but, as the plants proceed in development, the developmental gap between wild-type and transgenic lines is progressively reduced (Fig. 5D; Supplemental Table I). After 30 d from germination the number and length of adventitious roots in wild-type and transgenic lines are comparable although in the transgenic lines the aerenchyma is still at a more advanced stage of development (Fig. 6, H and I).
| + | ===Phenotypic analysis=== |
| | + | * Overexpression of '''''OsMADS18''''' in rice induced early flowering, and detailed histological analysis revealed that the formation of axillary shoot meristems was accelerated. Silencing of '''''OsMADS18''''' using an RNA interference approach did not result in any visible phenotypic alteration, indicating that OsMADS18 is probably redundant with other MADS box transcription factors. |
| | + | * Surprisingly, overexpression of '''''OsMADS18''''' in Arabidopsis caused a phenotype closely resembling the ap1 mutant. The ap1 phenotype is not caused by down-regulation of AP1 expression. |
| | + | * Yeast two-hybrid experiments showed that some of the natural partners of AP1 interact with OsMADS18, suggesting that the '''''OsMADS18''''' overexpression phenotype in Arabidopsis is likely to be due to the subtraction of AP1 partners from active transcription complexes. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | * This rice MADS box gene is widely expressed in rice with its transcripts accumulated to higher levels in meristems. |
| | | | |
| − | Expression of OsMADS18 in Arabidopsis Causes an ap1 Mutant Phenotype
| + | ===Evolution=== |
| − | AP1/SQUA-like genes, when overexpressed, generally cause an early flowering phenotype. To investigate whether OsMADS18 also induces early flowering in Arabidopsis we ectopically expressed OsMADS18 in this heterologous system. No significant effect on flowering time was observed, however, surprisingly, 10% of the plants (of a total of 100 transformants) showed floral phenotypes that were very similar to the ap1 mutant (Fig. 7H; Irish and Sussex, 1990; Bowmanet al., 1993). The mildest phenotypes show only a reduction in sepal and petal size (Fig. 7B). The result is that the pistil is not enclosed by the perianth organs and protrudes from the flower. Plants having an intermediate phenotype have flowers that in the first whorl develop leaf-like organs bearing stellate trichomes, which is typical for cauline leaves (Fig. 7C), while wild-type sepals have simple trichomes(Fig. 7A).Around 5% of the plants showed more severe phenotypes. Some of the first-whorl organs were homeotically converted to carpelloid organs on which ovules developed (Fig. 7F). In these severely affected flowers the petals were, in general, completely absent (Fig. 7, E and F). Frequently the most affected plants had flowers from which extra flowers arose from the axils of the first whorl organs (Fig. 7) and this pattern was reiterated producing tertiary and even quaternary flowers (Fig. 7G).
| + | * '''''OsMADS18''''' from rice (Oryza sativa) belongs to the phylogenetically defined AP1/SQUA group. |
| | + | * The MADS box genes of this group have functions in plant development, like controlling the transition from vegetative to reproductive growth, determination of floral organ identity, and regulation of fruit maturation. |
| | | | |
| − | ===Evolution===
| |
| − | Please input evolution information here.
| |
| | | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * Dipartimento di Biologia (F.F., L.P., N.P., S.C., L.C.) and Dipartimento di Scienze Biomolecolari e Biotecnologie (S.M., Z.L-D., M.M.K.), Università degli Studi di Milano, 20133 Milan, Italy; |
| | + | * Dipartimento di Biologia Vegetale, Università La Sapienza, 00185 Rome, Italy (G.F., M.M.A.) |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| | + | * <ref name="ref1"> |
| | + | Fornara F, Parenicová L, Falasca G, Pelucchi N, Masiero S, Ciannamea S, |
| | + | Lopez-Dee Z, Altamura MM, Colombo L, Kater MM. Functional characterization of |
| | + | OsMADS18, a member of the AP1/SQUA subfamily of MADS box genes. Plant Physiol. |
| | + | 2004 Aug;135(4):2207-19. PubMed PMID: 15299121; PubMed Central PMCID: PMC520791. |
| | + | </ref> |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os07g0605200|
| |
| − | Description = MADS box transcription factor 18 (OsMADS18) (MADS box protein 2) (MADS box protein 28) (FDRMADS7)|
| |
| − | Version = NM_001066760.1 GI:115473252 GeneID:4343851|
| |
| − | Length = 5204 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os07g0605200, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
| |
| − | AP = Chromosome 7:25448633..25453836|
| |
| − | CDS = 25448722..25448906,25451634..25451712,25451807..25451871,25451951..25452050,25452166..25452207<br>,25452799..25452837,25452934..25453067,25453482..25453587|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008400:25448633..25453836
| |
| − | source=RiceChromosome07
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008400:25448633..25453836
| |
| − | source=RiceChromosome07
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggggagagggccggtgcagctgcggcggatcgagaacaagataaacaggcaggtgaccttctccaagcggaggaacgggctgctgaagaaggcgcacgagatctccgtgctctgtgacgccgacgtcgcgctcatcgtcttctccaccaagggcaagctctacgagttctccagccactccagtatggaagggatccttgaacgctaccagcgttactcgtttgatgaaagagccgtactggagccaaatactgaggaccaggaaaactggggtgatgaatatggaattttgaagtccaaactggatgcacttcagaagagccaaaggcaactcttaggtgaacaattggacacactaacaataaaagaactccagcaattggaacatcaactggaatattctctgaagcatataagatcaaaaaagaatcagcttctgtttgaatcaatttctgagcttcagaagaaggaaaagtcacttaaaaaccagaataatgttctgcaaaagctcatggagacagaaaaggagaaaaacaatgctataataaacactaaccgggaggagcaaaatggagcaacaccaagcacatcatcaccaacaccagtgacggctccagatcccatcccgacaacaaataacagtcaaagccaaccaagaggatcaggggagtcagaagctcaaccgtctccggcacaagcaggcaacagcaagcttccgccatggatgctccggacaagtcacacatga</cdnaseq>|
| |
| − | AA = <aaseq>MGRGPVQLRRIENKINRQVTFSKRRNGLLKKAHEISVLCDADVA LIVFSTKGKLYEFSSHSSMEGILERYQRYSFDERAVLEPNTEDQENWGDEYGILKSKL DALQKSQRQLLGEQLDTLTIKELQQLEHQLEYSLKHIRSKKNQLLFESISELQKKEKS LKNQNNVLQKLMETEKEKNNAIINTNREEQNGATPSTSSPTPVTAPDPIPTTNNSQSQ PRGSGESEAQPSPAQAGNSKLPPWMLRTSHT</aaseq>|
| |
| − | DNA = <dnaseqindica>90..274#3002..3080#3175..3239#3319..3418#3534..3575#4167..4205#4302..4435#4850..4955#ctccccccatttccatcttccccgagctctccaccctccacccgccaccgccaccgccgccttcgccgccgccgccgccgccgacgacgatggggagagggccggtgcagctgcggcggatcgagaacaagataaacaggcaggtgaccttctccaagcggaggaacgggctgctgaagaaggcgcacgagatctccgtgctctgtgacgccgacgtcgcgctcatcgtcttctccaccaagggcaagctctacgagttctccagccactccaggtacgcacgcgcttagctcctcctcctcctcctcctcctctccgcgacctcccgcctacctacgtagtacggcccatgcccgtcgcctttcctcgccgcgcgcgcgccatgggcgagctcgcggagctccccgttcctgggcggcttgttgatgcgttcgatttcgtttcgtacgggttcctgccttgtgttcgatcgtttccgctgcggaatgcgagggggctggtggtgttggtgcgtgtacgattgctattatttcgtgctgattgatttctctcatgtgctctctgattgcacatacggttcatggctttgtacgtgttcgttcgtgcgattgctgcttagctcgggatggagttgctcgcgaagtctagctagttgtaggttgcttgtgtcccctggattacagctctctatgtgatgctggcatgctgctgctgctgctgccatgcatatcagaagctagtaatatacagtggtggtacatgcactgttgctgatttagctttatatgctgctcagttttgttcttggggactcatcaatcatcgtagcattggtgaacacgttcacttccatttttttttgtataaaaaggaatggaataataggtgaaaaaaaattcatgtgcttcatcagtacgggcggaaagaaagatatgtttaaattttaattagtgtgcttatctaggtttatcatatgcttatactcttgtgtactgtagcatatacaagtgatgcttattaccaaagcctagctaggccggtaaacttgtattatttgtctcgttatttctggaaatcattagagcagcacttcagttgaaatatgcacggacgccttgctaattaagcggctcctctaaccaggccagtaaggtcttaagttactgacaactcctggactggtataaatggcgcggccagctttacatgacatatggtttgatacttttgtttagttaatttcgaggtggaatataaggtgaccagcttacttaacttgttcatttgatgcattcggtttcatttccctttttttttttaagataatgggaagtaaattaatacccggccttgctttaactgaaactacaactttcttttgtccctttagtgtgtactgtcaccaagttagctatacatggtgcaagttgccattgcccattgctattaacttgctctcacaaattggggtgtttatttcttgaaatggattttttaggacaacaataaactgattgacatagctatactgttcaagtataaccatgtttatggttttcaattaagcaaactgcttatgtttatgctaatatcttttgtttaatgggaggaatttaaatatttcattattggtattcctatactctattatttcataatatttggcaattttgaccggtgattgcttcagtttaaccattaatatcttttaaaatttatgattatgatggatgggatttatatctctatatttaccattaccatgtaacatactttaataatatgttacataatctaatactaaaagtttatttataaaattggaatggccaaactaaaacaatgcgaacttaaaatcaccaagtattatgaaatggagggagcataatatcagtagctcgtaagggaaaaaagggacctaaatgatgccttttgtgataaatataatttcaaatttgcaaaatttttggataggcaacaatactctctcattattgtgttagtattaaggtcaagctacttctatgctaccaaatactccttctgttcctttttttatttcttgtctaggatattgacattatccctaacacacatctttctttgtatgatcatctactcataaaatagttaaaatataactacattattcaattatgaatctatgaatgttatttttatacaccgagttgggaactattctaaactctcgaggggacatcccctcattatctgcatgttatccaaacggttgtgaaaaaaattgaaaaaaaataaacaagatagattaatatgtgataaatcactccacaaacatgcaaggacaaattcaaattctacaagttgcaatgaaaaaattaaatttgaccgtgaatatacattaactagccatagtttaatttttttttgttgtaacttgtagaagttgaatttgaacttgcatgtttgtgaagtaatctatcacatattaatctatcttgtcgatttttttttaaaaaaatcataaccatttagatgacatgcaaaaaacgaggggatgttcccttgagagtttagaatccattctccagtgagttgatgttgagatttgattacacatttcaaaacgacttttatttgttaacgaagggagtaatgtggattcaccatatgtactaatgttattaaggccagataatcctttttttaatcattctaattagatataaacttacgacgaagaacatgaatggataaagtttcagccaacaaatacaaatgtttttcaaagtgctatttctgatgcataatttttgtagcagttatgatttaaatttatacatggataatttgaataatggatcctacttttgtagttgtcacctgacaagccttaagaattattgagggtacaaaaattataactgtgcatttgtttgatattgctctaagactatgcttggcatcatcttttgatgcattggtcaaaccaaagcataatcatgtgatacttcttctgtagtatggaagggatccttgaacgctaccagcgttactcgtttgatgaaagagccgtactggagccaaatactgaggaccaggtaaaaaaacatccctgactgttggagaactatctccggctgtttatttaactagctggttagttatctgatcttgatattcattttctcctaggaaaactggggtgatgaatatggaattttgaagtccaaactggatgcacttcagaagagccaaaggtactgcaaactttcttaagaaattttcactttggtaacaagattatgctaacttgagttggtctatctactgctcaaggcaactcttaggtgaacaattggacacactaacaataaaagaactccagcaattggaacatcaactggaatattctctgaagcatataagatcaaaaaaggtgaaatttgtgtccattatgcactgttgactgagggatcaaatttgcttgatttaattatttccaactaatctttgaaaacatcattactttcctttttgtttttcttttgcagaatcagcttctgtttgaatcaatttctgagcttcagaagaaggtaggttaccctcaatgtggctccttaaatagcaatgtagcagtctgtttataccatattgttttggagtattaaagttgcattcaaacaattttcagacaactaactcttcttgccttctaccagaatatattcatgtaaaacatgtcttttggcaattctagaaattccattataagaagaaatcattagtcaatttgaatcacctaaggaactaacgagaagccacttgtcttggtcatattgtgggaaatgcacaatgttgtcaaatgggtataacaggaaagtcgccatcaatgtatatattctaggggagagagaacagactaagtcagactacgttgtaaaattgaacattctacgggaaaataaatcttcgatgcatatggcaaggacttgaccgttagccttttacgcaataatgtatgcataaacatagggaaaaaaaaggacctgcactactgattgttactgtatctgatctggcaagtggcaacagagccatgttaatattgtgctgagaaatggacgaagttgatataggttcgtgctgatgaatattcttacaatctgctatcttcctgtctgcaggaaaagtcacttaaaaaccagaataatgttctgcaaaaggtaaatttcattcttgtttacaacaatgttttatatcagatcactacaaaagctgtattggaggtcaaacccttttgtctacattcttcggagcagctcatggagacagaaaaggagaaaaacaatgctataataaacactaaccgggaggagcaaaatggagcaacaccaagcacatcatcaccaacaccagtgacggctccagatcccatcccgacaacaaataacaggtaccgcttttacttccatatattttgcccctgcactcaccataaataaaacaaaactctgttttgttcttcagcaaatttttattctatattttttcttttatcagacttccattatctatcacagttcagtagtttttgatggtctatgcctaggaaacttaatccggtgaaatttgttcaatcaaatgctgccggtctatttcatatggctattggaagtttggaacaaataagcccaggcctgaaagcgcctgaaccaaacagtgaaaaagcctccaaatggtttggtctcagcttgatatatcatgtctgaacaataacttgacgttaggaatgatctagcatgttactactatttcatcaactccattgtctgttttagttatgctgtttttcctcatcttaattcagtcaaagccaaccaagaggatcaggggagtcagaagctcaaccgtctccggcacaagcaggcaacagcaagcttccgccatggatgctccggacaagtcacacatgaaggcatctgttgatctcaaacgtcactccactcaatggccaacatcaacatgtttcttccaactaaggcagccactgttgtgcaatccatcttccagcgatattgatatatcggcattcggcatagccaatatatattaatgtaatgtatcttgtcaaagcttcatagggttaatgacgccttgagcttctctgttctatatctgtcttgtaacgatctttgcatatctgctgcatttttttttctctc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066760.1 RefSeq:Os07g0605200]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |