Difference between revisions of "Os04g0610400"

From RiceWiki
Jump to: navigation, search
(Function)
(Annotated Information)
 
(7 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os04g0610400''''' was reported as '''''OsAP2-39''''' in 2010 and 2011, respectively <ref name="ref1" /><ref name="ref2" /> by researchers from Canada and China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:312-Os04g0610400.png|right|thumb|327px|'''Figure 4.''' '' The size of roots system is significantly reduced by
 +
the OsAP2-39 overexpression in rice..<ref name="ref1" />.'']]
 +
 +
===Gene Symbol===
 +
*'''''Os04g0610400''''' '''''<=>''''' '''''OsAP2-39, OsERF#077, OsERF077, OsERF77, AP2/EREBP#149, AP2/EREBP149'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* The phytohormone ethylene is a key signaling molecule that regulates a variety of developmental processes and stress responses in plants. Transcriptional modulation is a pivotal process controlling ethylene synthesis, which further triggers the expression of stress-related genes and plant adaptation to stresses.
The interaction between phytohormones is an important mechanism which controls growth and developmental processes in plants. Deciphering these interactions is a crucial step in helping to develop crops with enhanced yield and resistance to environmental stresses. Controlling the expression level of OsAP2-39 which includes an APETALA 2 (AP2) domain leads to phenotypic changes in rice. Overexpression of OsAP2-39 leads to a reduction in yield by decreasing the biomass and the number of seeds in the transgenic rice lines. Global transcriptome analysis of the OsAP2-39 overexpression transgenic rice revealed the upregulation of a key Abscisic Acid (ABA) biosynthetic gene OsNCED-I which codes for 9-cis-epoxycarotenoid dioxygenase and leads to an increase in the endogenous ABA level. In addition to OsNCED-1, the gene expression analysis revealed the upregulation of a gene that codes for the Elongation of Upper most Internode (EUI) protein, an enzyme that catalyzes 16α, 17-epoxidation of non-13-hydroxylated GAs, which has been shown to deactivate gibberellins (GAs) in rice. The exogenous application of GA restores the wild-type phenotype in the transgenic line and ABA application induces the expression of EUI and suppresses the expression of OsAP2-39 in the wild-type line. These observations clarify the antagonistic relationship between ABA and GA and illustrate a mechanism that leads to homeostasis of these hormones. In vivo and in vitro analysis showed that the expression of both OsNCED-1 and EUI are directly controlled by OsAP2-39. Together, these results reveal a novel mechanism for the control of the ABA/GA balance in rice which is regulated by OsAP2-39 that in turn regulates plant growth and seed production.
+
* The APETALA-2-Like Transcription Factor OsAP2-39 Controls Key Interactions between Abscisic Acid and Gibberellin in Rice.
 +
* ERF protein '''''OsAP2-39''''' controls the ABA/gibberellins balance in rice, which in turn regulates plant growth and seed production.
 +
* '''''OsAP2-39''''' links the ABA production and GA deactivation processes which results in ABA/GA balance and homeostasis<ref name="ref1" /><ref name="ref2" />.
 +
 
 +
===Phenotypic analysis===
 +
* Controlling the expression level of '''''OsAP2-39''''' which includes an APETALA 2 (AP2) domain leads to phenotypic changes in rice.  
 +
* Overexpression of '''''OsAP2-39''''' leads to a reduction in yield by decreasing the biomass and the number of seeds in the transgenic rice lines.  
 +
* Global transcriptome analysis of the '''''OsAP2-39''''' overexpression transgenic rice revealed the upregulation of a key Abscisic Acid (ABA) biosynthetic gene OsNCED-I which codes for 9-cis-epoxycarotenoid dioxygenase and leads to an increase in the endogenous ABA level.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* overexpression of '''''OsERF3/OsAP2-39''''' suppressed ethylene synthesis.
 
+
* In vivo and in vitro analysis showed that the expression of both OsNCED-1 and EUI are directly controlled by OsAP2-39.
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Biotechnology Research Institute, Chinese Academy of Agricultural Sciences, Beijing, China,
 +
* National Key Facility of Crop Gene Resources and Genetic Improvement, Beijing, China
 +
* National Center for Plant Gene Research (Beijing), Beijing, China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Yaish MW, El-kereamy A, Zhu T, Beatty PH, Good AG, Bi YM, Rothstein SJ. The APETALA-2-like transcription factor OsAP2-39 controls key interactions between abscisic acid and gibberellin in rice. PLoS Genet. 2010 Sep 9;6(9):e1001098.</ref>
 +
 
 +
* <ref name="ref2">
 +
Wan L, Zhang J, Zhang H, Zhang Z, Quan R, Zhou S, Huang R. Transcriptional
 +
activation of OsDERF1 in OsERF3 and OsAP2-39 negatively modulates ethylene
 +
synthesis and drought tolerance in rice. PLoS One. 2011;6(9):e25216. doi:
 +
10.1371/journal.pone.0025216. PubMed PMID: 21966459; PubMed Central PMCID:
 +
PMC3180291.
 +
 
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os04g0610400|
 
Description = Similar to AP2 domain containing protein RAP2.6 (Fragment)|
 
Version = NM_001060364.1 GI:115460457 GeneID:4336947|
 
Length = 669 bp|
 
Definition = Oryza sativa Japonica Group Os04g0610400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
 
AP = Chromosome 4:31337819..31338487|
 
CDS = 31337819..31338487|
 
GCID = <gbrowseImage1>
 
name=NC_008397:31337819..31338487
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008397:31337819..31338487
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggctcccaggaacgccgccgaggccgtcgccgtcgccgtggcggagggcggaggagccggcatggagcccaggttccgcggcgtgaggaagcgcccgtggggcaggtacgcggcggagatccgcgacccggccaggaaggcgcgggtgtggctcggcaccttcgacaccgccgaggccgcggcgcgcgcctacgacagcgccgcgctccacttccgcgggcccaaggccaagaccaacttccccgtcgccttcgcgcacgcccaccaccacgccccgccgccgccgctgcccaaggcggcggcgctggccgtcgtcagcccgaccagcagcacggtcgagtcgtcctcccgggacacgcccgccgccgccccggtggcggccgcggccaaggcccaggtgcccgcctcgccttcgctcgatctgagcctcgggatgtcggccatggtggccgcccagccgttcctgttcctcgaccccagggtcgcggtgaccgtggccgtcgcggcaccggtgcctcgccggccggccgtcgtcagcgtcaagaaggaggtagctcgcctggacgagcagagcgacaccggctcgtcgtcatccgtggtggacgcctcgccggccgtcggcgtggggctcgacctgaacctgccgccgccgatcgaggaggcgtag</cdnaseq>|
 
AA = <aaseq>MAPRNAAEAVAVAVAEGGGAGMEPRFRGVRKRPWGRYAAEIRDP                    ARKARVWLGTFDTAEAAARAYDSAALHFRGPKAKTNFPVAFAHAHHHAPPPPLPKAAA                    LAVVSPTSSTVESSSRDTPAAAPVAAAAKAQVPASPSLDLSLGMSAMVAAQPFLFLDP                    RVAVTVAVAAPVPRRPAVVSVKKEVARLDEQSDTGSSSSVVDASPAVGVGLDLNLPPP                    IEEA</aaseq>|
 
DNA = <dnaseqindica>1..669#atggctcccaggaacgccgccgaggccgtcgccgtcgccgtggcggagggcggaggagccggcatggagcccaggttccgcggcgtgaggaagcgcccgtggggcaggtacgcggcggagatccgcgacccggccaggaaggcgcgggtgtggctcggcaccttcgacaccgccgaggccgcggcgcgcgcctacgacagcgccgcgctccacttccgcgggcccaaggccaagaccaacttccccgtcgccttcgcgcacgcccaccaccacgccccgccgccgccgctgcccaaggcggcggcgctggccgtcgtcagcccgaccagcagcacggtcgagtcgtcctcccgggacacgcccgccgccgccccggtggcggccgcggccaaggcccaggtgcccgcctcgccttcgctcgatctgagcctcgggatgtcggccatggtggccgcccagccgttcctgttcctcgaccccagggtcgcggtgaccgtggccgtcgcggcaccggtgcctcgccggccggccgtcgtcagcgtcaagaaggaggtagctcgcctggacgagcagagcgacaccggctcgtcgtcatccgtggtggacgcctcgccggccgtcggcgtggggctcgacctgaacctgccgccgccgatcgaggaggcgtag</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060364.1 RefSeq:Os04g0610400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 04:12, 8 March 2017

The rice Os04g0610400 was reported as OsAP2-39 in 2010 and 2011, respectively [1][2] by researchers from Canada and China.

Annotated Information

Figure 4. The size of roots system is significantly reduced by the OsAP2-39 overexpression in rice..[1].

Gene Symbol

  • Os04g0610400 <=> OsAP2-39, OsERF#077, OsERF077, OsERF77, AP2/EREBP#149, AP2/EREBP149

Function

  • The phytohormone ethylene is a key signaling molecule that regulates a variety of developmental processes and stress responses in plants. Transcriptional modulation is a pivotal process controlling ethylene synthesis, which further triggers the expression of stress-related genes and plant adaptation to stresses.
  • The APETALA-2-Like Transcription Factor OsAP2-39 Controls Key Interactions between Abscisic Acid and Gibberellin in Rice.
  • ERF protein OsAP2-39 controls the ABA/gibberellins balance in rice, which in turn regulates plant growth and seed production.
  • OsAP2-39 links the ABA production and GA deactivation processes which results in ABA/GA balance and homeostasis[1][2].

Phenotypic analysis

  • Controlling the expression level of OsAP2-39 which includes an APETALA 2 (AP2) domain leads to phenotypic changes in rice.
  • Overexpression of OsAP2-39 leads to a reduction in yield by decreasing the biomass and the number of seeds in the transgenic rice lines.
  • Global transcriptome analysis of the OsAP2-39 overexpression transgenic rice revealed the upregulation of a key Abscisic Acid (ABA) biosynthetic gene OsNCED-I which codes for 9-cis-epoxycarotenoid dioxygenase and leads to an increase in the endogenous ABA level.

Expression

  • overexpression of OsERF3/OsAP2-39 suppressed ethylene synthesis.
  • In vivo and in vitro analysis showed that the expression of both OsNCED-1 and EUI are directly controlled by OsAP2-39.

You can also add sub-section(s) at will.

Labs working on this gene

  • Biotechnology Research Institute, Chinese Academy of Agricultural Sciences, Beijing, China,
  • National Key Facility of Crop Gene Resources and Genetic Improvement, Beijing, China
  • National Center for Plant Gene Research (Beijing), Beijing, China

References

  1. 1.0 1.1 1.2 Yaish MW, El-kereamy A, Zhu T, Beatty PH, Good AG, Bi YM, Rothstein SJ. The APETALA-2-like transcription factor OsAP2-39 controls key interactions between abscisic acid and gibberellin in rice. PLoS Genet. 2010 Sep 9;6(9):e1001098.
  2. 2.0 2.1 Wan L, Zhang J, Zhang H, Zhang Z, Quan R, Zhou S, Huang R. Transcriptional activation of OsDERF1 in OsERF3 and OsAP2-39 negatively modulates ethylene synthesis and drought tolerance in rice. PLoS One. 2011;6(9):e25216. doi: 10.1371/journal.pone.0025216. PubMed PMID: 21966459; PubMed Central PMCID: PMC3180291.

Structured Information