Difference between revisions of "Os04g0610400"

From RiceWiki
Jump to: navigation, search
(References)
(Annotated Information)
 
(4 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os04g0610400''''' was reported as '''''OsAP2-39''''' in 2010 and 2011, respectively <ref name="ref1" /><ref name="ref2" /> by researchers from Canada and China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:312-Os04g0610400.png|right|thumb|327px|'''Figure 4.''' '' The size of roots system is significantly reduced by
 +
the OsAP2-39 overexpression in rice..<ref name="ref1" />.'']]
 +
 +
===Gene Symbol===
 +
*'''''Os04g0610400''''' '''''<=>''''' '''''OsAP2-39, OsERF#077, OsERF077, OsERF77, AP2/EREBP#149, AP2/EREBP149'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* The phytohormone ethylene is a key signaling molecule that regulates a variety of developmental processes and stress responses in plants. Transcriptional modulation is a pivotal process controlling ethylene synthesis, which further triggers the expression of stress-related genes and plant adaptation to stresses.
OsAP2-39 classes in rice APETALA-2 transcription factor, an AP2 domain containing a key control between ABA and GA interaction. Interactions between plant hormones is an important mechanism for regulating plant growth and development, analysis of these interactions is the key to improve yields and improved crop resistance to environmental stress. OsAP2-39 is abundantly expressed in anthers, booting the early roots also expressed. OsAP2-39 overexpression can cause phenotypic changes in transgenic rice variety, such as plant height reduction of 55%, 75% reduction of tillers, leaf number decreased by 74% heading delayed 1-2 weeks, more sensitive to dehydration, and ultimately due to biological and reducing the amount of grain number resulted in yields.. Controlling the expression level of OsAP2-39 which includes an APETALA 2 (AP2) domain leads to phenotypic changes in rice. Overexpression of OsAP2-39 leads to a reduction in yield by decreasing the biomass and the number of seeds in the transgenic rice lines. Global transcriptome analysis of the OsAP2-39 overexpression transgenic rice revealed the upregulation of a key Abscisic Acid (ABA) biosynthetic gene OsNCED-I which codes for 9-cis-epoxycarotenoid dioxygenase and leads to an increase in the endogenous ABA level. In addition to OsNCED-1, the gene expression analysis revealed the upregulation of a gene that codes for the Elongation of Upper most Internode (EUI) protein, an enzyme that catalyzes 16α, 17-epoxidation of non-13-hydroxylated GAs, which has been shown to deactivate gibberellins (GAs) in rice. The exogenous application of GA restores the wild-type phenotype in the transgenic line and ABA application induces the expression of EUI and suppresses the expression of OsAP2-39 in the wild-type line. These observations clarify the antagonistic relationship between ABA and GA and illustrate a mechanism that leads to homeostasis of these hormones. In vivo and in vitro analysis showed that the expression of both OsNCED-1 and EUI are directly controlled by OsAP2-39. Together, these results reveal a novel mechanism for the control of the ABA/GA balance in rice which is regulated by OsAP2-39 that in turn regulates plant growth and seed production.
+
* The APETALA-2-Like Transcription Factor OsAP2-39 Controls Key Interactions between Abscisic Acid and Gibberellin in Rice.
 +
* ERF protein '''''OsAP2-39''''' controls the ABA/gibberellins balance in rice, which in turn regulates plant growth and seed production.
 +
* '''''OsAP2-39''''' links the ABA production and GA deactivation processes which results in ABA/GA balance and homeostasis<ref name="ref1" /><ref name="ref2" />.
 +
 
 +
===Phenotypic analysis===
 +
* Controlling the expression level of '''''OsAP2-39''''' which includes an APETALA 2 (AP2) domain leads to phenotypic changes in rice.  
 +
* Overexpression of '''''OsAP2-39''''' leads to a reduction in yield by decreasing the biomass and the number of seeds in the transgenic rice lines.  
 +
* Global transcriptome analysis of the '''''OsAP2-39''''' overexpression transgenic rice revealed the upregulation of a key Abscisic Acid (ABA) biosynthetic gene OsNCED-I which codes for 9-cis-epoxycarotenoid dioxygenase and leads to an increase in the endogenous ABA level.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* overexpression of '''''OsERF3/OsAP2-39''''' suppressed ethylene synthesis.
 
+
* In vivo and in vitro analysis showed that the expression of both OsNCED-1 and EUI are directly controlled by OsAP2-39.
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Biotechnology Research Institute, Chinese Academy of Agricultural Sciences, Beijing, China,
 +
* National Key Facility of Crop Gene Resources and Genetic Improvement, Beijing, China
 +
* National Center for Plant Gene Research (Beijing), Beijing, China
  
 
==References==
 
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Yaish MW, El-kereamy A, Zhu T, Beatty PH, Good AG, Bi YM, Rothstein SJ. The APETALA-2-like transcription factor OsAP2-39 controls key interactions between abscisic acid and gibberellin in rice. PLoS Genet. 2010 Sep 9;6(9):e1001098.</ref>
 +
 +
* <ref name="ref2">
 +
Wan L, Zhang J, Zhang H, Zhang Z, Quan R, Zhou S, Huang R. Transcriptional
 +
activation of OsDERF1 in OsERF3 and OsAP2-39 negatively modulates ethylene
 +
synthesis and drought tolerance in rice. PLoS One. 2011;6(9):e25216. doi:
 +
10.1371/journal.pone.0025216. PubMed PMID: 21966459; PubMed Central PMCID:
 +
PMC3180291.
  
[1]Liyun Wan;Jianfei Zhang;Haiwen Zhang;Zhijin Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang
+
</ref>
Transcriptional Activation of OsDERF1 in OsERF3 and OsAP2-39 Negatively Modulates Ethylene Synthesis and Drought Tolerance in Rice
+
</references>
  PLoS ONE, 2011, 6(9): e25216
 
[2] Mahmoud W. Yaish;Ashraf El-kereamy;Tong Zhu;Perrin H. Beatty;Allen G. Good;Yong-Mei Bi;Steven J. Rothstein
 
  The APETALA-2-Like Transcription Factor OsAP2-39 Controls Key Interactions between Abscisic Acid and Gibberellin in Rice
 
  PLoS Genetics, 2010, 6(9): e1001098
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os04g0610400|
 
Description = Similar to AP2 domain containing protein RAP2.6 (Fragment)|
 
Version = NM_001060364.1 GI:115460457 GeneID:4336947|
 
Length = 669 bp|
 
Definition = Oryza sativa Japonica Group Os04g0610400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
 
AP = Chromosome 4:31337819..31338487|
 
CDS = 31337819..31338487|
 
GCID = <gbrowseImage1>
 
name=NC_008397:31337819..31338487
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008397:31337819..31338487
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggctcccaggaacgccgccgaggccgtcgccgtcgccgtggcggagggcggaggagccggcatggagcccaggttccgcggcgtgaggaagcgcccgtggggcaggtacgcggcggagatccgcgacccggccaggaaggcgcgggtgtggctcggcaccttcgacaccgccgaggccgcggcgcgcgcctacgacagcgccgcgctccacttccgcgggcccaaggccaagaccaacttccccgtcgccttcgcgcacgcccaccaccacgccccgccgccgccgctgcccaaggcggcggcgctggccgtcgtcagcccgaccagcagcacggtcgagtcgtcctcccgggacacgcccgccgccgccccggtggcggccgcggccaaggcccaggtgcccgcctcgccttcgctcgatctgagcctcgggatgtcggccatggtggccgcccagccgttcctgttcctcgaccccagggtcgcggtgaccgtggccgtcgcggcaccggtgcctcgccggccggccgtcgtcagcgtcaagaaggaggtagctcgcctggacgagcagagcgacaccggctcgtcgtcatccgtggtggacgcctcgccggccgtcggcgtggggctcgacctgaacctgccgccgccgatcgaggaggcgtag</cdnaseq>|
 
AA = <aaseq>MAPRNAAEAVAVAVAEGGGAGMEPRFRGVRKRPWGRYAAEIRDP                    ARKARVWLGTFDTAEAAARAYDSAALHFRGPKAKTNFPVAFAHAHHHAPPPPLPKAAA                    LAVVSPTSSTVESSSRDTPAAAPVAAAAKAQVPASPSLDLSLGMSAMVAAQPFLFLDP                    RVAVTVAVAAPVPRRPAVVSVKKEVARLDEQSDTGSSSSVVDASPAVGVGLDLNLPPP                    IEEA</aaseq>|
 
DNA = <dnaseqindica>1..669#atggctcccaggaacgccgccgaggccgtcgccgtcgccgtggcggagggcggaggagccggcatggagcccaggttccgcggcgtgaggaagcgcccgtggggcaggtacgcggcggagatccgcgacccggccaggaaggcgcgggtgtggctcggcaccttcgacaccgccgaggccgcggcgcgcgcctacgacagcgccgcgctccacttccgcgggcccaaggccaagaccaacttccccgtcgccttcgcgcacgcccaccaccacgccccgccgccgccgctgcccaaggcggcggcgctggccgtcgtcagcccgaccagcagcacggtcgagtcgtcctcccgggacacgcccgccgccgccccggtggcggccgcggccaaggcccaggtgcccgcctcgccttcgctcgatctgagcctcgggatgtcggccatggtggccgcccagccgttcctgttcctcgaccccagggtcgcggtgaccgtggccgtcgcggcaccggtgcctcgccggccggccgtcgtcagcgtcaagaaggaggtagctcgcctggacgagcagagcgacaccggctcgtcgtcatccgtggtggacgcctcgccggccgtcggcgtggggctcgacctgaacctgccgccgccgatcgaggaggcgtag</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060364.1 RefSeq:Os04g0610400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 04:12, 8 March 2017

The rice Os04g0610400 was reported as OsAP2-39 in 2010 and 2011, respectively [1][2] by researchers from Canada and China.

Annotated Information

Figure 4. The size of roots system is significantly reduced by the OsAP2-39 overexpression in rice..[1].

Gene Symbol

  • Os04g0610400 <=> OsAP2-39, OsERF#077, OsERF077, OsERF77, AP2/EREBP#149, AP2/EREBP149

Function

  • The phytohormone ethylene is a key signaling molecule that regulates a variety of developmental processes and stress responses in plants. Transcriptional modulation is a pivotal process controlling ethylene synthesis, which further triggers the expression of stress-related genes and plant adaptation to stresses.
  • The APETALA-2-Like Transcription Factor OsAP2-39 Controls Key Interactions between Abscisic Acid and Gibberellin in Rice.
  • ERF protein OsAP2-39 controls the ABA/gibberellins balance in rice, which in turn regulates plant growth and seed production.
  • OsAP2-39 links the ABA production and GA deactivation processes which results in ABA/GA balance and homeostasis[1][2].

Phenotypic analysis

  • Controlling the expression level of OsAP2-39 which includes an APETALA 2 (AP2) domain leads to phenotypic changes in rice.
  • Overexpression of OsAP2-39 leads to a reduction in yield by decreasing the biomass and the number of seeds in the transgenic rice lines.
  • Global transcriptome analysis of the OsAP2-39 overexpression transgenic rice revealed the upregulation of a key Abscisic Acid (ABA) biosynthetic gene OsNCED-I which codes for 9-cis-epoxycarotenoid dioxygenase and leads to an increase in the endogenous ABA level.

Expression

  • overexpression of OsERF3/OsAP2-39 suppressed ethylene synthesis.
  • In vivo and in vitro analysis showed that the expression of both OsNCED-1 and EUI are directly controlled by OsAP2-39.

You can also add sub-section(s) at will.

Labs working on this gene

  • Biotechnology Research Institute, Chinese Academy of Agricultural Sciences, Beijing, China,
  • National Key Facility of Crop Gene Resources and Genetic Improvement, Beijing, China
  • National Center for Plant Gene Research (Beijing), Beijing, China

References

  1. 1.0 1.1 1.2 Yaish MW, El-kereamy A, Zhu T, Beatty PH, Good AG, Bi YM, Rothstein SJ. The APETALA-2-like transcription factor OsAP2-39 controls key interactions between abscisic acid and gibberellin in rice. PLoS Genet. 2010 Sep 9;6(9):e1001098.
  2. 2.0 2.1 Wan L, Zhang J, Zhang H, Zhang Z, Quan R, Zhou S, Huang R. Transcriptional activation of OsDERF1 in OsERF3 and OsAP2-39 negatively modulates ethylene synthesis and drought tolerance in rice. PLoS One. 2011;6(9):e25216. doi: 10.1371/journal.pone.0025216. PubMed PMID: 21966459; PubMed Central PMCID: PMC3180291.

Structured Information