|
|
| (6 intermediate revisions by 3 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os03g0285700''''' was reported as '''''OsAPXa''''' in 2010 <ref name="ref1" /> by researchers from Japan. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os03g0285700''''' '''''<=>''''' '''''OsAPX1, APXa, OsAPx01, OsAPx1, OSAPX1, APx1, cAPX''''' |
| | + | |
| | ===Function=== | | ===Function=== |
| − | OsAPX1 is a member of ascorbate peroxidase (APX) family. It is a haeme-containing enzyme of the ascorbate glutathione cycle that detoxifies reactive oxygen species in plants by catalyzing the conversion of hydrogen peroxide to water using ascorbate as a specific electron donor. The OsAPX1 expression is stress regulated[1].
| + | * '''''OsAPXa''''' is a member of ascorbate peroxidase (APX) family. |
| − | OsAPX1 can affect the ability of rice plants to withstand chilling at the booting stage. When overexpress OsAPX1 in rice, it can increase APX activity which determine the antioxidant capacity. The levels of H2O2 and the MDA content increased by 1.5-fold and twofold, respectively in WT plants subjected to a 12℃ treatment for six days. In contrast, transgenic lines showed small changes in H2O2 levels and MDA content under cold stress, and H2O2 levels and MDA content were significantly lower than in WT plants. And the spikelet fertility was significantly higher in transgenic lines than in WT plants after a 12℃ treatment for six days. The reason is the APX activity enhances H2O2-scavenging capacity and protects spikelets, thereby increasing spikelet fertility under cold stress[2].
| + | * It is a haeme-containing enzyme of the ascorbate glutathione cycle that detoxifies reactive oxygen species in plants by catalyzing the conversion of hydrogen peroxide to water using ascorbate as a specific electron donor. |
| − | | + | * '''''OsAPXa''''' can affect the ability of rice plants to withstand chilling at the booting stage. When overexpress OsAPX1 in rice, it can increase APX activity which determine the antioxidant capacity. |
| − | ===Expression===
| |
| − | Please input expression information here.
| |
| − | Different APX isoforms are present in discrete subcellular compartments in rice and their expression is stress regulated.And OsAPX1 exist in the cytoplasm of rice.
| |
| − | OsAPX1 show a weak constitutive expression in leaves. Their transcripts were up-regulated upon wounding (by cut), and diverse signals such as salicylic acid (SA), ethylene (using the ethylene generator, ethephon), abscisic acid (ABA), hydrogen peroxide, copper sulfate, protein phosphatase (PP) inhibitors, cantharidin (CN), endothall (EN) and okadaic acid (OA), and blast pathogen (Magnaporthe grisea) attack, but surprisingly not by jasmonic acid (JA).
| |
| − | OsAPX1 mRNAs expression manifested a clear rhythmicity under light/dark cycle[3].
| |
| | | | |
| − | ===Evolution=== | + | ===Phenotypic analysis=== |
| − | Please input evolution information here.
| + | * To determine whether antioxidant capacity affects the ability of rice plants to withstand chilling at the booting stage, researhcers produced transgenic rice plants that overexpress '''''OsAPXa''''' and have increased APX activity. |
| | + | * The effect of increased APX activity on the levels of H2O2 and lipid peroxidation were determined by measuring H2O2 levels and malondialdehyde (MDA) contents in spikelets during cold treatments at the booting stage. |
| | + | * The levels of H2O2 and the MDA content increased by 1.5-fold and twofold, respectively in WT plants subjected to a 12°C treatment for 6 days. In contrast, transgenic lines showed small changes in H2O2 levels and MDA content under cold stress, and |
| | + | H2O2 levels and MDA content were significantly lower than in WT plants. |
| | + | * APX activity showed negative correlations with levels of H2O2 and MDA content, which increased during cold treatment. Cold tolerance at the booting stage in transgenic lines and WT plants was evaluated. |
| | + | * Spikelet fertility was significantly higher in transgenic lines than in WT plants after a 12°C treatment for 6 days. |
| | | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * National Agricultural Research Center for Hokkaido Region, Hitsujigaoka 1, Toyohira, Sapporo 062-8555, Japan |
| | + | * National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | * <ref name="ref1"> |
| − | [1]Saurabh Pandey; Yogesh Kumar Negi3;Subramanyam Chinreddy1;Krishnamurthy Sathelly1;
| + | Sato Y, Masuta Y, Saito K, Murayama S, Ozawa K. Enhanced chilling tolerance at |
| − | Sandeep Arora4;Tanushri Kaul1.
| + | the booting stage in rice by transgenic overexpression of the ascorbate |
| − | Modeling and phylogenetic analysis of cytosolic ascorbate peroxidase (OsAPX1) from rice reveal signature motifs that may play a role in stress tolerance.
| + | peroxidase gene, OsAPXa. Plant Cell Rep. 2011 Mar;30(3):399-406. doi: |
| − | Bioinformation,2014,10(3):119-123
| + | 10.1007/s00299-010-0985-7. PubMed PMID: 21203887. |
| − | [2]Yutaka Sato;Yukari Masuta;Koji Saito;Seiji Murayama;Kenjiro Ozawa
| + | </ref> |
| − | Enhanced chilling tolerance at the booting stage in rice by transgenic overexpression of the ascorbate peroxidase gene, OsAPXa
| + | </references> |
| − | Plant Cell Reports, 2011, 30(3): 399-406
| |
| − | [3]Ganesh Kumar Agrawal, Nam-Soo Jwac, Hitoshi Iwahashid, Randeep Rakwal
| |
| − | Importance of ascorbate peroxidases OsAPX1 and OsAPX2 in the rice pathogen response pathways and growth and reproduction revealed by their transcriptional profiling.
| |
| − | Gene, 2003, 322: 93-103
| |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os03g0285700|
| |
| − | Description = Similar to L-ascorbate peroxidase|
| |
| − | Version = NM_001056304.1 GI:115452336 GeneID:4332474|
| |
| − | Length = 3335 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os03g0285700, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
| |
| − | AP = Chromosome 3:9893999..9897333|
| |
| − | CDS = 9894067..9894185,9894281..9894455,9894550..9894615,9895972..9896020,9896354..9896439<br>,9896526..9896605,9896701..9896803,9896921..9896979,9897066..9897081<br>|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008396:9893999..9897333
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008396:9893999..9897333
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggctaagaactaccccgtcgtgagcgccgagtaccaggaggccgtcgagaaggccaggcagaagctgcgcgccctcatcgccgagaagagctgcgcccctctcatgctccgcctcgcgtggcactcggcggggacgttcgacgtgtcgtcgaagaccgggggcccgttcgggacgatgaagaccccggcggagctgtcgcacgccgccaacgcggggctggacatcgcggtgcggatgctcgagcccatcaaggaggagatacccaccatctcctacgccgatttctaccagcttgccggagttgtggccgtcgaggtgtccggtggacctgccgtccccttccacccaggaagggaggacaaacctgcacccccacctgagggccgtcttcctgatgctaccaagggttctgaccacctaaggcaggtcttcggtgcgcagatgggcttgagtgatcaggacattgttgccctctctggcggtcacaccctgggaaggtgccacaaggaaagatctggttttgagggaccttggacaagaaaccctctgcagtttgacaactcttacttcacggagcttctgagtggtgacaaggagggccttcttcagcttcctagtgacaaagccctgctgagtgaccctgccttccgcccactcgtcgagaaatatgctgcagatgagaaggctttctttgaagactacaaggaggcccacctcaagctctccgaactggggttcgctgatgcttaa</cdnaseq>|
| |
| − | AA = <aaseq>MAKNYPVVSAEYQEAVEKARQKLRALIAEKSCAPLMLRLAWHSA GTFDVSSKTGGPFGTMKTPAELSHAANAGLDIAVRMLEPIKEEIPTISYADFYQLAGV VAVEVSGGPAVPFHPGREDKPAPPPEGRLPDATKGSDHLRQVFGAQMGLSDQDIVALS GGHTLGRCHKERSGFEGPWTRNPLQFDNSYFTELLSGDKEGLLQLPSDKALLSDPAFR PLVEKYAADEKAFFEDYKEAHLKLSELGFADA</aaseq>|
| |
| − | DNA = <dnaseqindica>69..187#283..457#552..617#1974..2022#2356..2441#2528..2607#2703..2805#2923..2981#3068..3083#aagcctttcgagtcgtcttctccccttcttctcctcctcctcctcgattcggagctccacccgcagccatggctaagaactaccccgtcgtgagcgccgagtaccaggaggccgtcgagaaggccaggcagaagctgcgcgccctcatcgccgagaagagctgcgcccctctcatgctccgcctcgcgtaagccgtcgccctcgcactcgctcgcttctaggttttgtgtagaggcggatttccgtagactgatccggtttttgtggagacggatcgcgcaggtggcactcggcggggacgttcgacgtgtcgtcgaagaccgggggcccgttcgggacgatgaagaccccggcggagctgtcgcacgccgccaacgcggggctggacatcgcggtgcggatgctcgagcccatcaaggaggagatacccaccatctcctacgccgatttctaccaggttcgccgcgagccccggatagatctggatggacggccccgatctggtcaaacggacgtggttctgatgttttttccccgttgtttttgcgcagcttgccggagttgtggccgtcgaggtgtccggtggacctgccgtccccttccacccaggaagggaggtgagatttcctattacctttcaactcttggggtttttctcagggttctagttaggccttgatatggcagtggtaaactggatggcgtgtggatttgtttgtgatgccacgagattagtcgtaatttgttagtgctccattgatgtgtgtgcttttcatttgtggggactgggggttggtggttcctagagagtagacaaagtgatcaccactaatctaaggccagcagtataataatattttaacagtacggacttttctatattatatacccggataataccgtcaaattgggtttgttcgtattcttgttggtgggtcggcgttacttgacatcctctagatctagaggtggttaaatatccgtgacctcatttacatttccgtaagaccttgtttatttaccataaacatgctaattgttattttttagttattgttggctcatgtgtttgtgtcagttgagtcacataggattcattttcatgcatgctgtatggtgtgaagtttgttatccattcatgcacaaggatattatttttaaggatgtcgccttatcctttttctttgtagtctggctattctcaaagtagtcactgatttaccatggttgtttgcggcatttccctgttcagggttttgatagttactgatctttcattttatcatttttattttttactcaggatagtagttctcatcctaatcgatgtcatactctaaaccatgacaaataaacaattattttctgaattaatggaagaagccttggggacctggaagaagccttggggaccggggttgtttccgttctctatgcatgatatagtttgatctgttggattgtgccatgtaggatatttgttgtgctttgtgaatataaacttaagaaagcatccattatttacaagtctagttggttcagataaagtatattagggcctcccaacttattgcattgacataaaatgataattaggggttcaatctgaaggcagttggaaagcttaatgaaaaaacagtgggccgatatatatctatatgttatgttttaggaaactttagaaaggtgacttggtgcttgttttaggatataataactgttatggatatatctttttttataaatacataatgttcagtaattattatgcaccttcaacaatatcaccgatgatagtaatatatatcatatatgtaacattatacagtgcttaaaatttgcttgtgcatatctggctcatctttatatttatttctaaaatggagagatgattaagtgtttttttatgttccattttatattcattgtgttgttaattgagattgttttcatccttccttgaccttttgcaggacaaacctgcacccccacctgagggccgtcttcctgatgctaccaagggtatgttgccagtttacactactagtctcttccaggaactatagaaacattcaccactattgccataaaagaaacccttgcaaataagtcatcctttaaaatgtttttgtttctgcaatagttgaggtgttatttctgtgtagcacatctaaaatgcttagttatggtagaagtttttcccactgcacacttgacaaatgattcctgtgttgttgtaggcatgttgtatttttctgcatgcttcatttctgatatgatcctgctttgaccttgttctagtaaacctcatgtaaagcaccattgcttacactttgagcttgattgctttaccaggttctgaccacctaaggcaggtcttcggtgcgcagatgggcttgagtgatcaggacattgttgccctctctggcggtcacaccctggttagtttggctattaaccattgtatgcctctgcagtatgtaggagtacatgttctaatgtcggatttctgtgctttgttctgcagggaaggtgccacaaggaaagatctggttttgagggaccttggacaagaaaccctctgcagtttgacaactcttacttcacgtaagcgatgttacgagtggttgaattttgttcttatgctgaacaaagttggtaacaaaaatgttgaactcatctctccgcgacgattttaatagggagcttctgagtggtgacaaggagggccttcttcagcttcctagtgacaaagccctgctgagtgaccctgccttccgcccactcgtcgagaaatatgctgcagtatgtctcctatcaatcatcatcttgtgttccacgttttgcatcttgtgttcctcgttttgcagagatatgccagaacatgatactgattgtgttttttttccccaattctgctaggatgagaaggctttctttgaagactacaaggaggcccacctcaagctctccgaactggggtgagtaatggtttgtcaatccatttatcgtgttatctttcatgacaacaaggtcatggtagctaattgtactcttgtgatttcaggttcgctgatgcttaagaggtttctagtctactactgctagtacattgcccgtggtactcttgttttgcatctaggctagggccagtgtgaaccagcagactaccactgtgagtcgcctctgtaataaaatttgttcggcctatggccatcctcagtacgttgtcaatgtctcggtgggctgttatgctcaactgcaatgctgcatccactgaaacctctttctagatgtgttggtatgaaatgcggtattgcgttcccgatttcccc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056304.1 RefSeq:Os03g0285700]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |