Difference between revisions of "Os02g0181300"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Gene Symbol)
 
(4 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os02g0181300''''' was reported as '''''OsWRKY71''''' in 2007 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os02g0181300''''' '''''<=>''''' '''''OsWRKY71''''','''''WRKY71'''''
 +
 
===Function===
 
===Function===
WRKY proteins constitute a family of mostly plant-specific zinc-finger transcription factors composed of 74 and 109 members in Arabidopsis and rice, respectively.A common feature of WRKY proteins is the WRKY domain, which is defined by a region of approximately 60 amino acids containing a conserved WRKYGQK amino acid sequence adjacent to a zinc-finger-like motif.Both regions are necessary for high-affinity binding to a canonical Wb-box motif containing a consensus sequence (C/T)TGAC
+
* '''''OsWRKY71''''' might function in rice biotic stress response.
(C/T). Based on primary structure, WRKY proteins have been classified into three groups (I, II, and III) and various subgroups (e.g., IIa, IIb, etc.)
+
* '''''OsWRKY71''''' might function as a transcriptional regulator upstream of OsNPR1 and OsPR1b in rice defense signaling pathways.
 +
 
 +
===Phenotypic analysis===
 +
* To investigate the subcellular localization of OsWRKY71 protein, the cDNA sequence of the OsWRKY71 gene was fused in frame to the 39 end of the green fluorescent protein (GFP) gene that is driven by the constitutive maize Ubiquitin (UBI) promoter.  
 +
* The fusion construct, UBI-GFP:OsWRKY71 and the control construct UBI-GFP were introduced, respectively, into barley aleurone cells by bombardment. Confocal microscopic observations indicated that GFP fluorescence was detected in the whole cell bombarded with the control construct UBIGFP.
 +
* By contrast, the GFP:OsWRKY71 fusion protein was targeted to the nucleus. Aleurone cell nuclei were stained with SYTO17, which released red fluorescence.
 +
 
 +
===Phenotypic analysis===
 +
*  Overexpression of '''''OsWRKY71''''' gene in rice resulted in enhanced resistance to virulent bacterial pathogens Xanthomonas oryzae pv. oryzae (Xoo) 13751.  
 +
* Furthermore, two marker genes in defense signaling pathway, OsNPR1 and OsPR1b, were constitutively expressed in '''''OsWRKY71'''''-overexpressing transgenic plants.
  
 
===Expression===
 
===Expression===
The WRKYssRNAi construct was introduced into Kitaake plants by Agrobacterium-mediated transformation. The presence of the transgene in individually transformed plants was confirmed by PCR (data not shown). To determine the RNA levels of the endogenous OsWRKY IIa genes, real-time polymerase chain reaction (RT-PCR) was performed on RNA samples from 17 transgenic lines using gene-specific primers (Fig. 1b). Surprisingly, super-overexpression of all four genes was observed in nine transgenic lines when compared to the wild type controls (Fig. 2a). Four transgenic lines showed silencing of all four genes, called supersilencing, as expected (Fig. 2b), and four lines showed little change in gene expression relative to the controls. To ensure that the inserted construct is transcribed as expected, the gus linker expression was examined using RTPCR. As shown in Fig. 2, the gus linker expression was detected in all 17 transgenic lines.
+
* '''''OsWRKY71''''' was up-regulated by several defense signaling molecules, such as SA, methyl jasmonate (MeJA), 1-aminocyclo-propane-1-carboxylic acid (ACC), as well as wounding and pathogen infection.
  
 +
===Subcellular localization===
 +
* Transient expression of '''''OsWRKY71''''':GFP fusion protein in onion epidermis cells revealed that '''''OsWRKY71''''' was localized in the nucleus.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* WRKY proteins are a large family of transcription factors that mainly participate in plant biotic stress responses.
 +
* So far, one hundred and five OsWRKY genes have been predicted in the rice genome.
 +
* OsWRKY IIa subfamily members play both positive and negative regulatory roles in regulating plant innate immunity.  
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* National Key Laboratory of Plant Genomics and Plant Gene Research Center (Beijing), Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Datun Road, Beijing 100101, China
 +
* Graduate School of the Chinese Academy of Sciences, Yuquan Road, Beijing 100039, China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 
+
* <ref name="ref1">
 +
Liu X, Bai X, Wang X, Chu C. OsWRKY71, a rice transcription factor, is
 +
involved in rice defense response. J Plant Physiol. 2007 Aug;164(8):969-79.
 +
PubMed PMID: 16919842.
 +
</ref>
 +
</references>
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os02g0181300|
 
Description = WRKY transcription factor 71 (Transcription factor WRKY09)|
 
Version = NM_001052629.1 GI:115444628 GeneID:4328512|
 
Length = 1393 bp|
 
Definition = Oryza sativa Japonica Group Os02g0181300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:4543031..4544423|
 
CDS = 4543031..4543177,4543287..4543709,4543836..4543952,4544064..4544423|
 
GCID = <gbrowseImage1>
 
name=NC_008395:4543031..4544423
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:4543031..4544423
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggatccgtggattagcacccagccttcgctgagcctggacctccgcgtcgggctgccggcgacggcggccgtcgccatggttaagcccaaggtgctcgtcgaggaggacttctttcaccagcagcctctcaagaaagacccagaggttgcggcgctggaggcggagctgaagcggatgggcgcggagaaccggcagctgagcgagatgctggcggcggtggcggccaagtacgaggcgctgcagagccagttcagcgacatggtcaccgccagcgccaacaacggcggcggcggcggcaacaacccgtcgtccacctccgagggcggctccgtctcgccgtcgaggaagcgcaagagcgagagcctcgacgactccccgccgccgccgccgccgccgcacccacacgcggcgccgcaccacatgcacgtcatgcccggcgccgccgccgccggctacgccgaccagaccgagtgcacctccggcgagccctgcaagcgcatccgcgaggagtgcaagcccaagatctccaagctctacgtccacgccgacccatccgacctcagcctggtggtgaaagatgggtaccaatggaggaagtatggtcagaaggtcaccaaggacaacccctgcccaagagcctacttcagatgctcatttgctcccgcctgccctgtcaagaagaaggttcagagaagcgcggaggacaacacgatcctcgtggcgacgtacgagggggagcacaaccacggccagccgccgccgccgctgcagtcggcggcgcagaacagcgacggctccggcaagagcgccgggaagccaccccatgcgccggcggcggcgccgccggcgccggtggtgccgcaccgtcagcacgaaccggtcgtcgtcaacggcgagcagcaggccgcggcggcgtcggagatgatcaggcggaacctggccgagcagatggcgatgacgctgacgcgtgacccaagcttcaaggcggcgctcgtcaccgccctctccggccgcatcctcgagctctcgccgaccaaggattga</cdnaseq>|
 
AA = <aaseq>MDPWISTQPSLSLDLRVGLPATAAVAMVKPKVLVEEDFFHQQPL                    KKDPEVAALEAELKRMGAENRQLSEMLAAVAAKYEALQSQFSDMVTASANNGGGGGNN                    PSSTSEGGSVSPSRKRKSESLDDSPPPPPPPHPHAAPHHMHVMPGAAAAGYADQTECT                    SGEPCKRIREECKPKISKLYVHADPSDLSLVVKDGYQWRKYGQKVTKDNPCPRAYFRC                    SFAPACPVKKKVQRSAEDNTILVATYEGEHNHGQPPPPLQSAAQNSDGSGKSAGKPPH                    APAAAPPAPVVPHRQHEPVVVNGEQQAAAASEMIRRNLAEQMAMTLTRDPSFKAALVT                    ALSGRILELSPTKD</aaseq>|
 
DNA = <dnaseqindica>1..147#257..679#806..922#1034..1393#atggatccgtggattagcacccagccttcgctgagcctggacctccgcgtcgggctgccggcgacggcggccgtcgccatggttaagcccaaggtgctcgtcgaggaggacttctttcaccagcagcctctcaagaaagacccagaggtaggtcatgtgattaagcatacgtgcacggacgatcgacggccgccatggctgggagcgtgatgagcttaatttcttgagctgatttggggttttttttgttgtgaaggttgcggcgctggaggcggagctgaagcggatgggcgcggagaaccggcagctgagcgagatgctggcggcggtggcggccaagtacgaggcgctgcagagccagttcagcgacatggtcaccgccagcgccaacaacggcggcggcggcggcaacaacccgtcgtccacctccgagggcggctccgtctcgccgtcgaggaagcgcaagagcgagagcctcgacgactccccgccgccgccgccgccgccgcacccacacgcggcgccgcaccacatgcacgtcatgcccggcgccgccgccgccggctacgccgaccagaccgagtgcacctccggcgagccctgcaagcgcatccgcgaggagtgcaagcccaagatctccaagctctacgtccacgccgacccatccgacctcagcctggtacgaatccccaaccccaattaacatccgatcatctcatttcatgtgcctaacttaacttctttttgttctgaattctagccttgattaattaattaatcctgttcttgcaatgaatccatgcaggtggtgaaagatgggtaccaatggaggaagtatggtcagaaggtcaccaaggacaacccctgcccaagagcctacttcagatgctcatttgctcccgcctgccctgtcaagaagaaggtaacttaaattcctctaactaattccaaagtgatttcgtaagttttgctaaatttagtgcaaattcgagcctgtttctgaactttgttcgtggttcaaatgttgtttcaggttcagagaagcgcggaggacaacacgatcctcgtggcgacgtacgagggggagcacaaccacggccagccgccgccgccgctgcagtcggcggcgcagaacagcgacggctccggcaagagcgccgggaagccaccccatgcgccggcggcggcgccgccggcgccggtggtgccgcaccgtcagcacgaaccggtcgtcgtcaacggcgagcagcaggccgcggcggcgtcggagatgatcaggcggaacctggccgagcagatggcgatgacgctgacgcgtgacccaagcttcaaggcggcgctcgtcaccgccctctccggccgcatcctcgagctctcgccgaccaaggattga</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052629.1 RefSeq:Os02g0181300]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 04:49, 8 March 2017

The rice Os02g0181300 was reported as OsWRKY71 in 2007 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os02g0181300 <=> OsWRKY71,WRKY71

Function

  • OsWRKY71 might function in rice biotic stress response.
  • OsWRKY71 might function as a transcriptional regulator upstream of OsNPR1 and OsPR1b in rice defense signaling pathways.

Phenotypic analysis

  • To investigate the subcellular localization of OsWRKY71 protein, the cDNA sequence of the OsWRKY71 gene was fused in frame to the 39 end of the green fluorescent protein (GFP) gene that is driven by the constitutive maize Ubiquitin (UBI) promoter.
  • The fusion construct, UBI-GFP:OsWRKY71 and the control construct UBI-GFP were introduced, respectively, into barley aleurone cells by bombardment. Confocal microscopic observations indicated that GFP fluorescence was detected in the whole cell bombarded with the control construct UBIGFP.
  • By contrast, the GFP:OsWRKY71 fusion protein was targeted to the nucleus. Aleurone cell nuclei were stained with SYTO17, which released red fluorescence.

Phenotypic analysis

  • Overexpression of OsWRKY71 gene in rice resulted in enhanced resistance to virulent bacterial pathogens Xanthomonas oryzae pv. oryzae (Xoo) 13751.
  • Furthermore, two marker genes in defense signaling pathway, OsNPR1 and OsPR1b, were constitutively expressed in OsWRKY71-overexpressing transgenic plants.

Expression

  • OsWRKY71 was up-regulated by several defense signaling molecules, such as SA, methyl jasmonate (MeJA), 1-aminocyclo-propane-1-carboxylic acid (ACC), as well as wounding and pathogen infection.

Subcellular localization

  • Transient expression of OsWRKY71:GFP fusion protein in onion epidermis cells revealed that OsWRKY71 was localized in the nucleus.

Evolution

  • WRKY proteins are a large family of transcription factors that mainly participate in plant biotic stress responses.
  • So far, one hundred and five OsWRKY genes have been predicted in the rice genome.
  • OsWRKY IIa subfamily members play both positive and negative regulatory roles in regulating plant innate immunity.

You can also add sub-section(s) at will.

Labs working on this gene

  • National Key Laboratory of Plant Genomics and Plant Gene Research Center (Beijing), Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Datun Road, Beijing 100101, China
  • Graduate School of the Chinese Academy of Sciences, Yuquan Road, Beijing 100039, China

References

  1. Liu X, Bai X, Wang X, Chu C. OsWRKY71, a rice transcription factor, is involved in rice defense response. J Plant Physiol. 2007 Aug;164(8):969-79. PubMed PMID: 16919842.

Structured Information