Difference between revisions of "Os02g0121300"

From RiceWiki
Jump to: navigation, search
(Expression)
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os02g0121300''''' was reported as '''''OsCYP2''''' in 2011 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os02g0121300''''' '''''<=>''''' '''''CYC2, cyc2*, cyc2, OsCYP2, CYP19-2, OsCYP-2, OsCyp2-P, OsCyp2, OsCYP19-1'''''
 +
 
===Function===
 
===Function===
Os02g0121300 is a cyclophilin gene.It encoding OsCYP2 protein,which interact with co-chaperone Suppressor of G2 allele of skp1(OsSGT1) to effect the process of the degradation of auxin-responsive proteins.It is important in rice lateral root initiation. Futhermore, another study shows that OsCYP2 expression can be induced by salt stress and circadian rhythm. And OsCYP2 able to control Reactive Oxygen Species(ROS) level as a modulator through mediate the activities of antioxidant enzymes at translation level.
+
* '''''OsCYP2''''' is a cyclophilin gene.
 +
* It encoding OsCYP2 protein,which interact with co-chaperone Suppressor of G2 allele of skp1(OsSGT1) to effect the process of the degradation of auxin-responsive proteins.
 +
* '''''OsCYP2''''' confers salt tolerance in rice (Oryza sativa L.) seedlings when over-expressed.
 +
* '''''OsCYP2''''' may act as a key regulator that controls ROS level by modulating activities of antioxidant enzymes at translation level.
 +
* '''''OsCYP2''''' is also likely to act as a key component that is involved in signal pathways of other types of stresses-PEG, heat, cold, or ABA.
 +
 
 +
===Phenotypic analysis===
 +
* Phenotypic analysis of one protein that was upregulated during salt-induced stress, cyclophilin 2 (OsCYP2), indicated that '''''OsCYP2''''' transgenic rice seedlings had better tolerance to salt stress than did wild-type seedlings.
 +
* Interestingly, wild-type seedlings exhibited a marked reduction in maximal photochemical efficiency under salt stress, whereas no such change was observed for OsCYP2-transgenic seedlings.
 +
* '''''OsCYP2'''''-transgenic seedlings had lower levels of lipid peroxidation products and higher activities of antioxidant enzymes than wild-type seedlings.
  
 
===Expression===
 
===Expression===
By the trial of qPCR,it is found that OsCYP2 expressed in various tissues, and GUS signal appeared in the root`s RAM region and lateral root`s RAM region. GUS signal appeared in the late stages of lateral root initiation, as well as both the crown and root primordia, leaves, vascular lemma(Kang et al. 2013).
+
* '''''OsCYP2''''' expression is not only induced by salt stress, but also regulated by circadian rhythm.
 
+
* Spatiotemporal expression analysis of '''''OsCYP2''''' showed that it could be induced by salt stress in both Shanyou 10 and Liangyoupeijiu seedlings, but Shanyou 10 seedlings showed higher OsCYP2 expression levels.  
''OsCYP2'' expression induced by salt stress and circadian rhythms.It is able to express in bud, but almost no expression in roots. In addition, ''OsCYP2'' circadian express in Shanyou 10 is earlier than in Liangyoupei 9. Using PEG, heat damage and seedling ABA treatment can induce the ''OsCYP2'' expression in seedling of shangyou 10.However,those treatment inhibit OsCYP2 expression in Liangyoupei 9.(Ruan et al. 2011).
+
* Moreover, circadian rhythm expression of '''''OsCYP2''''' in Shanyou 10 seedlings occurred earlier than in Liangyoupeijiu seedlings.
 
+
* Treatment with PEG, heat, or ABA induced '''''OsCYP2''''' expression in Shanyou 10 seedlings but inhibited its expression in Liangyoupeijiu seedlings. Cold stress inhibited OsCYP2 expression in Shanyou 10 and Liangyoupeijiu seedlings.  
===Evolution===
+
* In addition, '''''OsCYP2''''' was strongly expressed in shoots but rarely in roots in two rice hybrid varieties.
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Plant Molecular Biology & Proteomics Lab, Institute of Biotechnology, Hangzhou Academy of Agricultural Sciences, Hangzhou 310024, PR China.
 
+
* National Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou 310006, PR China.
 
==References==
 
==References==
[1]Bo Kang;Zhongchen Zhang;Lingling Wang;Libin Zheng;Weihua Mao;Meifei Li;Yunrong Wu;Ping Wu;Xiaorong Mo. OsCYP2, a chaperone involved in degradation of auxin-responsive proteins, plays crucial roles in rice lateral root initiation. The Plant Journal, 2013, 74(1): 86-97
+
<references>
 
+
* <ref name="ref1">
[2]Song-Lin Ruan;Hua-Sheng Ma;Shi-Heng Wang;Ya-Ping Fu;Ya Xin;Wen-Zhen Liu;Fang Wang;Jian-Xin Tong;Shu-Zhen Wang;Hui-Zhe Chen.Proteomic identification of OsCYP2, a rice cyclophilin that confers salt tolerance in rice (Oryza sativa L.) seedlings when overexpressed.''BMC'' Plant Biology, 2011, 11: 34
+
Ruan SL, Ma HS, Wang SH, Fu YP, Xin Y, Liu WZ, Wang F, Tong JX, Wang SZ, Chen  
 +
HZ. Proteomic identification of OsCYP2, a rice cyclophilin that confers salt
 +
tolerance in rice (Oryza sativa L.) seedlings when overexpressed. BMC Plant Biol.
 +
2011 Feb 16;11:34. doi: 10.1186/1471-2229-11-34. PubMed PMID: 21324151; PubMed
 +
Central PMCID: PMC3050798.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0121300|
 
Description = Cyclophilin 2|
 
Version = NM_001052252.1 GI:115443874 GeneID:4328121|
 
Length = 887 bp|
 
Definition = Oryza sativa Japonica Group Os02g0121300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:1116066..1116952|
 
CDS = 1116160..1116678|
 
GCID = <gbrowseImage1>
 
name=NC_008395:1116066..1116952
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:1116066..1116952
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtcgaacacgagggtgttcttcgacatgaccgtcggcggagctccggcggggcggatcgtgatggagctgtacgcgaaggacgtgccgcggacggcggagaacttccgcgcgctctgcaccggcgagaagggcgtgggcaagagcggcaagccgctgcactacaaggggagcaccttccaccgcgtgatcccggagttcatgtgccagggcggcgacttcacccgcggcaacggcacgggaggggagtcgatctacggcgagaagttcgccgacgaggtgttcaagttcaagcacgacagccccggcatcctgtccatggcgaacgccgggcccaacactaacgggtcccagttcttcatctgcaccgtgccctgcagctggctggacgggaagcacgtcgtgttcggccgcgtcgtcgagggcatggacgtcgtcaaggccatcgagaaggtgggatcccgcggcgggagcaccgccaagccggtcgtcatcgccgactgcggccagctctcctag</cdnaseq>|
 
AA = <aaseq>MSNTRVFFDMTVGGAPAGRIVMELYAKDVPRTAENFRALCTGEK                    GVGKSGKPLHYKGSTFHRVIPEFMCQGGDFTRGNGTGGESIYGEKFADEVFKFKHDSP                    GILSMANAGPNTNGSQFFICTVPCSWLDGKHVVFGRVVEGMDVVKAIEKVGSRGGSTA                    KPVVIADCGQLS</aaseq>|
 
DNA = <dnaseqindica>95..613#acgcagcgatctgaagtgaaacagcaaaaaaaatcaaacaaaaagaaaaaatattccccatctgtgaaattcgcaaaaccctagcgcggcggcgatgtcgaacacgagggtgttcttcgacatgaccgtcggcggagctccggcggggcggatcgtgatggagctgtacgcgaaggacgtgccgcggacggcggagaacttccgcgcgctctgcaccggcgagaagggcgtgggcaagagcggcaagccgctgcactacaaggggagcaccttccaccgcgtgatcccggagttcatgtgccagggcggcgacttcacccgcggcaacggcacgggaggggagtcgatctacggcgagaagttcgccgacgaggtgttcaagttcaagcacgacagccccggcatcctgtccatggcgaacgccgggcccaacactaacgggtcccagttcttcatctgcaccgtgccctgcagctggctggacgggaagcacgtcgtgttcggccgcgtcgtcgagggcatggacgtcgtcaaggccatcgagaaggtgggatcccgcggcgggagcaccgccaagccggtcgtcatcgccgactgcggccagctctcctagatctgtgctgttccccttcgcctttcgccagtatcagtcgtcttgagtcgtcgagtccctaaataaggaggaggtggtggtggtgttagtctttttatgagttcgtgtcgtgttggtgagatgagatcgcccatggtttggttggattaggcggagttcttggatcgattcggtggagttggatctgcgatccttcttggggttggttttaaatcttaattcgtgtcgctgcttctatgatatcgctatcaatcaatgagaacatttgggatcc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052252.1 RefSeq:Os02g0121300]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 04:58, 8 March 2017

The rice Os02g0121300 was reported as OsCYP2 in 2011 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os02g0121300 <=> CYC2, cyc2*, cyc2, OsCYP2, CYP19-2, OsCYP-2, OsCyp2-P, OsCyp2, OsCYP19-1

Function

  • OsCYP2 is a cyclophilin gene.
  • It encoding OsCYP2 protein,which interact with co-chaperone Suppressor of G2 allele of skp1(OsSGT1) to effect the process of the degradation of auxin-responsive proteins.
  • OsCYP2 confers salt tolerance in rice (Oryza sativa L.) seedlings when over-expressed.
  • OsCYP2 may act as a key regulator that controls ROS level by modulating activities of antioxidant enzymes at translation level.
  • OsCYP2 is also likely to act as a key component that is involved in signal pathways of other types of stresses-PEG, heat, cold, or ABA.

Phenotypic analysis

  • Phenotypic analysis of one protein that was upregulated during salt-induced stress, cyclophilin 2 (OsCYP2), indicated that OsCYP2 transgenic rice seedlings had better tolerance to salt stress than did wild-type seedlings.
  • Interestingly, wild-type seedlings exhibited a marked reduction in maximal photochemical efficiency under salt stress, whereas no such change was observed for OsCYP2-transgenic seedlings.
  • OsCYP2-transgenic seedlings had lower levels of lipid peroxidation products and higher activities of antioxidant enzymes than wild-type seedlings.

Expression

  • OsCYP2 expression is not only induced by salt stress, but also regulated by circadian rhythm.
  • Spatiotemporal expression analysis of OsCYP2 showed that it could be induced by salt stress in both Shanyou 10 and Liangyoupeijiu seedlings, but Shanyou 10 seedlings showed higher OsCYP2 expression levels.
  • Moreover, circadian rhythm expression of OsCYP2 in Shanyou 10 seedlings occurred earlier than in Liangyoupeijiu seedlings.
  • Treatment with PEG, heat, or ABA induced OsCYP2 expression in Shanyou 10 seedlings but inhibited its expression in Liangyoupeijiu seedlings. Cold stress inhibited OsCYP2 expression in Shanyou 10 and Liangyoupeijiu seedlings.
  • In addition, OsCYP2 was strongly expressed in shoots but rarely in roots in two rice hybrid varieties.

You can also add sub-section(s) at will.

Labs working on this gene

  • Plant Molecular Biology & Proteomics Lab, Institute of Biotechnology, Hangzhou Academy of Agricultural Sciences, Hangzhou 310024, PR China.
  • National Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou 310006, PR China.

References

  1. Ruan SL, Ma HS, Wang SH, Fu YP, Xin Y, Liu WZ, Wang F, Tong JX, Wang SZ, Chen HZ. Proteomic identification of OsCYP2, a rice cyclophilin that confers salt tolerance in rice (Oryza sativa L.) seedlings when overexpressed. BMC Plant Biol. 2011 Feb 16;11:34. doi: 10.1186/1471-2229-11-34. PubMed PMID: 21324151; PubMed Central PMCID: PMC3050798.

Structured Information