|
|
| (5 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| |
| − |
| |
| | ==Annotated Information== | | ==Annotated Information== |
| − | Rice at reproductive stage is more sensitive to environmental changes. Os01g0112400 play a role in response to heat stress. | + | Rice at reproductive stage is more sensitive to environmental changes. Os01g0112400 plays a role in response to heat stress. |
| − | | |
| − | In the rice genome, transporter family genes are grouped into 4 distinct types: ATP-dependent transporters, secondary transporters, ion channels, and unclassified transporters. As a gene related to sugar, peptide, amino acid and other metabolites transport,most genes are heat-induced or identified as HR genes. While OsTIP4;1(Os01g0112400) and OsTIP4;1(Os05g0231700) were continuously late elevated during heating in rice panicle . the reason is still unknown.
| |
| − | | |
| − | ===Expression===
| |
| − | Please input expression information here.
| |
| − | | |
| − | ===Evolution===
| |
| − | Please input evolution information here.
| |
| − | | |
| − | You can also add sub-section(s) at will.
| |
| | | | |
| − | Key Laboratory for Crop Germplasm Innovation and Utilization of Hunan Province, Hunan Agricultural University, Changsha, China
| |
| | | | |
| − | College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha, China
| |
| | | | |
| − | ==References==
| |
| − | Please input cited references here.
| |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os01g0112400|
| |
| − | Description = Major intrinsic protein family protein|
| |
| − | Version = NM_001048348.1 GI:115434109 GeneID:4326119|
| |
| − | Length = 1125 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os01g0112400, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
| |
| − | AP = Chromosome 1:644598..645722|
| |
| − | CDS = 644732..645418,645524..645697|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008394:644598..645722
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008394:644598..645722
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgacaacggatcatgccgggaagaaagtcgacgtcgtcgtggttggcaacgttgacggcgagcacgtcggagtagagcaagctcgccatgatctgcacgaggaggcggcggcggcggcggcggctgaccatcatgccaccagaggcctagccattggctttctcatacgagaggtgatggtggaggggttggcgtcgttcttggtggtgttctggtcgtgcgtggcggcgctgatgcaggagatgtacgggacgctgacgttcccgatggtgtgcctggtggtggcgatgacggtggcgttcgttctcagctggctcggcccggcgcacttcaacccggccgtcaccatcaccttcgccgcctaccgccgcttcccggtctggcccaagctgccgctctacgtcgccgcccagctcgccggctcgctcctcgcctgcctctccgtcaacgccgtcatgaggccgcgccacgaccacttctacggcacggcgcccgtcgtcgtccacggcacccgcctccccttcctcatggagttcctcgcctccgccgtcctcatgatcgtcatcgccaccgtcgccaccgacggcacagcggggaagacggtgggagggatcgccatcggagcggcggtgggagggctggggctggtgatcgggccggtgtcgggagggtcgatgaacccggcgaggacgctggggccggcgatcgtgctgggcaggtacgacggcgtgtggatctacgtggtggcgcccgtcgccgggatgctggtcggcgcgctctgcaaccgcgccgtcaggctctcccaccgcatcgtcgccttcctctgcggcacctctgttgggatcgccggctcgccctag</cdnaseq>|
| |
| − | AA = <aaseq>MTTDHAGKKVDVVVVGNVDGEHVGVEQARHDLHEEAAAAAAADH HATRGLAIGFLIREVMVEGLASFLVVFWSCVAALMQEMYGTLTFPMVCLVVAMTVAFV LSWLGPAHFNPAVTITFAAYRRFPVWPKLPLYVAAQLAGSLLACLSVNAVMRPRHDHF YGTAPVVVHGTRLPFLMEFLASAVLMIVIATVATDGTAGKTVGGIAIGAAVGGLGLVI GPVSGGSMNPARTLGPAIVLGRYDGVWIYVVAPVAGMLVGALCNRAVRLSHRIVAFLC GTSVGIAGSP</aaseq>|
| |
| − | DNA = <dnaseqindica>305..991#26..199#gaatgagatactaattaatactgaaatgacaacggatcatgccgggaagaaagtcgacgtcgtcgtggttggcaacgttgacggcgagcacgtcggagtagagcaagctcgccatgatctgcacgaggaggcggcggcggcggcggcggctgaccatcatgccaccagaggcctagccattggctttctcatacgagaggtaggtacatataatgtctgcaaatttatgattaattgatacacataaaaccctttgcatgaattgaattgaaccgatgaatggatggcaatggcgatggagcaggtgatggtggaggggttggcgtcgttcttggtggtgttctggtcgtgcgtggcggcgctgatgcaggagatgtacgggacgctgacgttcccgatggtgtgcctggtggtggcgatgacggtggcgttcgttctcagctggctcggcccggcgcacttcaacccggccgtcaccatcaccttcgccgcctaccgccgcttcccggtctggcccaagctgccgctctacgtcgccgcccagctcgccggctcgctcctcgcctgcctctccgtcaacgccgtcatgaggccgcgccacgaccacttctacggcacggcgcccgtcgtcgtccacggcacccgcctccccttcctcatggagttcctcgcctccgccgtcctcatgatcgtcatcgccaccgtcgccaccgacggcacagcggggaagacggtgggagggatcgccatcggagcggcggtgggagggctggggctggtgatcgggccggtgtcgggagggtcgatgaacccggcgaggacgctggggccggcgatcgtgctgggcaggtacgacggcgtgtggatctacgtggtggcgcccgtcgccgggatgctggtcggcgcgctctgcaaccgcgccgtcaggctctcccaccgcatcgtcgccttcctctgcggcacctctgttgggatcgccggctcgccctagctaccacactagagcttagccctccatatatatatccacagaataattcgcctccattatgatagctgcatgaacacgacgagcatcgctgcactgaaattgttttggaccaaccaatagagattttccatccc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001048348.1 RefSeq:Os01g0112400]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| − | [[Category:Japonica mRNA]]
| |
| | [[Category:Oryza Sativa Japonica Group]] | | [[Category:Oryza Sativa Japonica Group]] |
| − | [[Category:Japonica Genes]]
| |
| | [[Category:Japonica Chromosome 1]] | | [[Category:Japonica Chromosome 1]] |
| − | [[Category:Chromosome 1]]
| |