|
|
| (One intermediate revision by one other user not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| |
| − |
| |
| | ==Annotated Information== | | ==Annotated Information== |
| | Rice at reproductive stage is more sensitive to environmental changes. Os01g0112400 plays a role in response to heat stress. | | Rice at reproductive stage is more sensitive to environmental changes. Os01g0112400 plays a role in response to heat stress. |
| | | | |
| − | ==Function==
| |
| − |
| |
| − | In the rice genome, transporter family genes are grouped into 4 distinct types: ATP-dependent transporters, secondary transporters, ion channels, and unclassified transporters. As a gene related to sugar, peptide, amino acid and other metabolites transport,most genes are heat-induced or identified as HR genes. While OsTIP4;1(Os01g0112400) and OsTIP4;1(Os05g0231700) were continuously late elevated during heating in rice panicle . the reason is still unknown.
| |
| − |
| |
| − |
| |
| − | ===Laboratory===
| |
| − |
| |
| − |
| |
| − | Key Laboratory for Crop Germplasm Innovation and Utilization of Hunan Province, Hunan Agricultural University, Changsha, China
| |
| − |
| |
| − | College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha, China
| |
| − |
| |
| − | National Institute of Agrobiological Sciences, Ibaraki305-8602, Japan,
| |
| − |
| |
| − | Biological Information Research Center, National Institute of Advanced Industrial Science and Technology, Japan,
| |
| − |
| |
| − | Japan Biological Informatics Consortium, Tokyo 135-0064, Japan,
| |
| − |
| |
| − | Okayama University Graduate School of Medicine,Dentistry and Pharmaceutical Sciences, Innovation Center Okayama for Nanobio-targeted Therapy, Okayama 700-8558, Japan,
| |
| − |
| |
| − | Department of Biological Sciences, Tokyo Metropolitan University, Tokyo 192-0397, Japan,
| |
| − |
| |
| − | Center for Information Biology and DNA Data Bank of Japan, National Institute of Genetics, Research Organization of Information and Systems, Shizuoka 411-8540, Japan,
| |
| − |
| |
| − | Institute of Botany, Academia Sinica,Taipei 11529, Taiwan,
| |
| − |
| |
| − | Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200233,China,
| |
| − |
| |
| − | Cold Spring Harbor Laboratory, NY 11723,USA,
| |
| − |
| |
| − | European Bioinformatics Institute, Wellcome Trust Genome Campus, Cambridge, CB10 1SD, UK,
| |
| − |
| |
| − | Graduate School of Information Science and Technology, Hokkaido University, Hokkaido 060-0814,Japan,
| |
| − |
| |
| − | Department of Plant Molecular Biology,University of Delhi South Campus, New Delhi 110021,India,
| |
| − |
| |
| − | National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute,New Delhi 110012, India,
| |
| − |
| |
| − | Institute for Bioinformatics/MIPS, GSF National Research Center for Environment and Health, D-85764 Neuherberg, Germany,
| |
| − |
| |
| − | Institute of the Society for Techno-innovation of Agriculture, Forestry and Fisheries, Ibaraki 305-0854, Japan,
| |
| − |
| |
| − | Crop Research Informatics Laboratory, International Rice Research Institute, Metro Manila, Philippines,
| |
| − |
| |
| − | Department of Biology, McGill University, Quebec H3A 1B1, Canada,
| |
| − |
| |
| − | Tsukuba Division, Mitsubishi Space Software Co., Ltd., Ibaraki 305-0032, Japan,
| |
| − |
| |
| − | Centre for Comparative Genomics, Murdoch University, Western Australia 6150, Australia,
| |
| − |
| |
| − | Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya 464-8601, Japan,
| |
| − |
| |
| − | National Center for Biotechnology D1032 Nucleic Acids Research, 2008, Vol. 36, Database issue Information, National Institutes of Health, MD 20894,USA,
| |
| − |
| |
| − | Pohang University of Science and Technology,Pohang 790-784, Korea,
| |
| − |
| |
| − | RIKEN BioResource Center,RIKEN Tsukuba Institute, Ibaraki 305-0074, Japan,
| |
| − |
| |
| − | Waksman Institute of Microbiology, RutgersUniversity, NJ 08854,
| |
| − |
| |
| − | Stanford University MedicalCenter, CA 94305-5120, USA,
| |
| | | | |
| − | Swiss-Prot Group, Swiss Institute of Bioinformatics, Geneva 1206, Switzerland,
| |
| | | | |
| − | ===Research articles===
| |
| − | Xianwen Zhang, Jiaping Li, Ailing Liu et al.Expression Profile in Rice Panicle: Insights into Heat Response Mechanism at Reproductive Stage[J]PLOS. ONE 2012
| |
| − | http://www.plosone.org/article/info%3Adoi%2F10.1371%2Fjournal.pone.0049652#pone-0049652-g010
| |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os01g0112400|
| |
| − | Description = Major intrinsic protein family protein|
| |
| − | Version = NM_001048348.1 GI:115434109 GeneID:4326119|
| |
| − | Length = 1125 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os01g0112400, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
| |
| − | AP = Chromosome 1:644598..645722|
| |
| − | CDS = 644732..645418,645524..645697|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008394:644598..645722
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008394:644598..645722
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgacaacggatcatgccgggaagaaagtcgacgtcgtcgtggttggcaacgttgacggcgagcacgtcggagtagagcaagctcgccatgatctgcacgaggaggcggcggcggcggcggcggctgaccatcatgccaccagaggcctagccattggctttctcatacgagaggtgatggtggaggggttggcgtcgttcttggtggtgttctggtcgtgcgtggcggcgctgatgcaggagatgtacgggacgctgacgttcccgatggtgtgcctggtggtggcgatgacggtggcgttcgttctcagctggctcggcccggcgcacttcaacccggccgtcaccatcaccttcgccgcctaccgccgcttcccggtctggcccaagctgccgctctacgtcgccgcccagctcgccggctcgctcctcgcctgcctctccgtcaacgccgtcatgaggccgcgccacgaccacttctacggcacggcgcccgtcgtcgtccacggcacccgcctccccttcctcatggagttcctcgcctccgccgtcctcatgatcgtcatcgccaccgtcgccaccgacggcacagcggggaagacggtgggagggatcgccatcggagcggcggtgggagggctggggctggtgatcgggccggtgtcgggagggtcgatgaacccggcgaggacgctggggccggcgatcgtgctgggcaggtacgacggcgtgtggatctacgtggtggcgcccgtcgccgggatgctggtcggcgcgctctgcaaccgcgccgtcaggctctcccaccgcatcgtcgccttcctctgcggcacctctgttgggatcgccggctcgccctag</cdnaseq>|
| |
| − | AA = <aaseq>MTTDHAGKKVDVVVVGNVDGEHVGVEQARHDLHEEAAAAAAADH HATRGLAIGFLIREVMVEGLASFLVVFWSCVAALMQEMYGTLTFPMVCLVVAMTVAFV LSWLGPAHFNPAVTITFAAYRRFPVWPKLPLYVAAQLAGSLLACLSVNAVMRPRHDHF YGTAPVVVHGTRLPFLMEFLASAVLMIVIATVATDGTAGKTVGGIAIGAAVGGLGLVI GPVSGGSMNPARTLGPAIVLGRYDGVWIYVVAPVAGMLVGALCNRAVRLSHRIVAFLC GTSVGIAGSP</aaseq>|
| |
| − | DNA = <dnaseqindica>305..991#26..199#gaatgagatactaattaatactgaaatgacaacggatcatgccgggaagaaagtcgacgtcgtcgtggttggcaacgttgacggcgagcacgtcggagtagagcaagctcgccatgatctgcacgaggaggcggcggcggcggcggcggctgaccatcatgccaccagaggcctagccattggctttctcatacgagaggtaggtacatataatgtctgcaaatttatgattaattgatacacataaaaccctttgcatgaattgaattgaaccgatgaatggatggcaatggcgatggagcaggtgatggtggaggggttggcgtcgttcttggtggtgttctggtcgtgcgtggcggcgctgatgcaggagatgtacgggacgctgacgttcccgatggtgtgcctggtggtggcgatgacggtggcgttcgttctcagctggctcggcccggcgcacttcaacccggccgtcaccatcaccttcgccgcctaccgccgcttcccggtctggcccaagctgccgctctacgtcgccgcccagctcgccggctcgctcctcgcctgcctctccgtcaacgccgtcatgaggccgcgccacgaccacttctacggcacggcgcccgtcgtcgtccacggcacccgcctccccttcctcatggagttcctcgcctccgccgtcctcatgatcgtcatcgccaccgtcgccaccgacggcacagcggggaagacggtgggagggatcgccatcggagcggcggtgggagggctggggctggtgatcgggccggtgtcgggagggtcgatgaacccggcgaggacgctggggccggcgatcgtgctgggcaggtacgacggcgtgtggatctacgtggtggcgcccgtcgccgggatgctggtcggcgcgctctgcaaccgcgccgtcaggctctcccaccgcatcgtcgccttcctctgcggcacctctgttgggatcgccggctcgccctagctaccacactagagcttagccctccatatatatatccacagaataattcgcctccattatgatagctgcatgaacacgacgagcatcgctgcactgaaattgttttggaccaaccaatagagattttccatccc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001048348.1 RefSeq:Os01g0112400]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| − | [[Category:Japonica mRNA]]
| |
| | [[Category:Oryza Sativa Japonica Group]] | | [[Category:Oryza Sativa Japonica Group]] |
| − | [[Category:Japonica Genes]]
| |
| | [[Category:Japonica Chromosome 1]] | | [[Category:Japonica Chromosome 1]] |
| − | [[Category:Chromosome 1]]
| |