Difference between revisions of "Os09g0380200"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Labs working on this gene)
 
(5 intermediate revisions by 4 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os09g0380200''''' was reported as '''''ylc1''''' in 2013 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:198-Os09g0380200.png|right|thumb|427px|'''Figure 8.''' ''Subcellular localization of YLC1, ylc1 and truncated YLC1s in rice protoplasts..<ref name="ref1" />.'']]
 +
===Gene Symbol===
 +
*'''''Os09g0380200''''' '''''<=>''''' '''''OsYCL1''''','''''ylc1'''''
 
===Function===
 
===Function===
Chlorophyll (Chl) and lutein are the two most abundant and essential components in photosynthetic apparatus, and play critical roles in plant development. In this study, we characterized a rice mutant named young leaf chlorosis 1 (ylc1) from a 60Co-irradiated population. Young leaves of the ylc1 mutant showed decreased levels of Chl and lutein compared to those of wild type, and transmission electron microscopy analysis revealed that the thylakoid lamellar structures were obviously loosely arranged. Whereas, the mutant turns green gradually and approaches normal green at the maximum tillering stage. The Young Leaf Chlorosis 1 (YLC1) gene was isolated via map-based cloning and identified to encode a protein of unknown function belonging to the DUF3353 superfamily. Complementation and RNA-interference tests confirmed the role of the YLC1 gene, which expressed in all tested rice tissues, especially in the leaves. Real-time PCR analyses showed that the expression levels of the genes associated with Chl biosynthesis and photosynthesis were affected in ylc1 mutant at different temperatures. In rice protoplasts, the YLC1 protein displayed a typical chloroplast location pattern. The N-terminal 50 amino acid residues were confirmed to be necessary and sufficient for chloroplast targeting. These data suggested that the YLC1 protein may be involved in Chl and lutein accumulation and chloroplast development at early leaf development in rice.
+
* The Young Leaf Chlorosis 1 ('''''YLC1''''') gene was isolated via map-based cloning and identified to encode a protein of unknown function belonging to the DUF3353 superfamily.
 +
* The rice'''''OsYLC1''''' may be involved in Chl and lutein accumulation and chloroplast development at early leaf development in rice.
 +
===Phenotypic analysis===
 +
* The researchers characterized a rice mutant named young leaf chlorosis 1 (ylc1) from a 60 Co-irradiated population.  
 +
* Young leaves of the ylc1 mutant showed decreased levels of Chl and lutein compared to those of wild type, and transmission electron microscopy analysis revealed that the thylakoid lamellar structures were obviously loosely arranged.  
 +
* Whereas, the mutant turns green gradually and approaches normal green at the maximum tillering stage.
  
===Expression===
+
===Subcellular localization===
Young Leaf Chlorosis 1, a chloroplast-localized gene required for chlorophyll and lutein accumulation during early leaf development in rice
+
* Subcellular localization analysis in rice protoplasts demonstrated that the first 50 N-terminal amino acid residues are essential and sufficient for the protein localization to the chloroplast.
 
 
===Evolution===
 
Both Chls and Cars were measured using a spectrophotometer according to the method of Arnon (1949) with minor modifications. Briefly, equal weights of freshly
 
collected second top leaves from 10-day-old, 14-day-old and 30-day-old seedlings were marinated in 95 % ethanol for 48 h under dark conditions. Residual plant debris was removed by centrifugation. The supernatants were analyzed with a DU 800 UV/Vis Spectrophotometer (Beckman Coulter) at 665, 649 and 470 nm, respectively.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University, Nanjing 210095, China
 +
* National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing 100081, China
  
 
==References==
 
==References==
 +
<references>
 
<ref name="ref1">  Kunneng Zhou;Yulong Ren;Jia Lv;Yihua Wang;Feng Liu;Feng Zhou;Shaolu Zhao;Saihua Chen;Cheng Peng;Xin Zhang;Xiuping Guo;Zhijun Cheng;Jiulin Wang;Fuqing Wu;Ling Jiang;Jianmin Wan. Young Leaf Chlorosis 1, a chloroplast-localized gene required for chlorophyll and lutein accumulation during early leaf development in rice. Planta, 2013, 237(1): 279-292 </ref>
 
<ref name="ref1">  Kunneng Zhou;Yulong Ren;Jia Lv;Yihua Wang;Feng Liu;Feng Zhou;Shaolu Zhao;Saihua Chen;Cheng Peng;Xin Zhang;Xiuping Guo;Zhijun Cheng;Jiulin Wang;Fuqing Wu;Ling Jiang;Jianmin Wan. Young Leaf Chlorosis 1, a chloroplast-localized gene required for chlorophyll and lutein accumulation during early leaf development in rice. Planta, 2013, 237(1): 279-292 </ref>
 
+
</references>
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os09g0380200|
 
Description = Conserved hypothetical protein|
 
Version = NM_001069588.1 GI:115478918 GeneID:4346927|
 
Length = 1061 bp|
 
Definition = Oryza sativa Japonica Group Os09g0380200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:13431725..13432785|
 
CDS = 13431849..13432058,13432357..13432433,13432523..13432673|
 
GCID = <gbrowseImage1>
 
name=NC_008402:13431725..13432785
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:13431725..13432785
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgaagagctaccagcagcggaaaaagactaagattaatctgaaaactaagctaaaaaagcgagttgaggaatccccgtcatgggtaaaggcactgcttggatattttgaggtgccacaaatggatatcatttcaagaagattgttctttttcgctttcattgctggttggagcatagcgacttctgctgagaatggacctgcattccagcttgcaatatctctcttctcgtgcatatatttccttaatgataagatgaagaacctcatgagggcatcaacaactgggtttggagtgcttgttggtggctggataattggctctctattggtcccacttatcccaacattcatcatcccaccctcttggtcccttgagctacttacatcattagttgcatatgtcttcctgttcctgggttgcactttcctcaaatga</cdnaseq>|
 
AA = <aaseq>MKSYQQRKKTKINLKTKLKKRVEESPSWVKALLGYFEVPQMDII                    SRRLFFFAFIAGWSIATSAENGPAFQLAISLFSCIYFLNDKMKNLMRASTTGFGVLVG                    GWIIGSLLVPLIPTFIIPPSWSLELLTSLVAYVFLFLGCTFLK</aaseq>|
 
DNA = <dnaseqindica>125..334#633..709#799..949#tcttggtgttgatcgtgatgcagctgaagaagagatcaggagtgctagaaatttccttattcaacagtatgctgggcatgaaccaagtgaagaagctattgaaggtgcatacgagaagataataatgaagagctaccagcagcggaaaaagactaagattaatctgaaaactaagctaaaaaagcgagttgaggaatccccgtcatgggtaaaggcactgcttggatattttgaggtgccacaaatggatatcatttcaagaagattgttctttttcgctttcattgctggttggagcatagcgacttctgctgagaatggacctgcattccaggtatctgtgctttggtttttgctggcctttcaagttgtttttttcttgtttgatgacatatttcaattcatagcagtccaagaaggcaatctagtttgcacgtaaaatgcatatgcttgttcattcatctgaaaatttaaattatccaatgtaaccaacatctcttgttgagggtataaagacaatgcaaggcctaataactcctaaattttaaatatttatgcaatactagcttaatacacttcccatcttgagcacaacttctctagttgactagtttttttttttccttttgcagcttgcaatatctctcttctcgtgcatatatttccttaatgataagatgaagaacctcatgagggcatcaacaactgggttagtgggaattttttcacttgatatccatcggaccgtagcttgcctactttgatatcaatatcatgcttactcttttgttcttccaggtttggagtgcttgttggtggctggataattggctctctattggtcccacttatcccaacattcatcatcccaccctcttggtcccttgagctacttacatcattagttgcatatgtcttcctgttcctgggttgcactttcctcaaatgaaaaccttgtaaatcttgtaaccgtaaattgtagaattgcttgcagaaattttgcaactactgacatctccactatgggtctcggaaaagttttgtagaatgacatcactttg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069588.1 RefSeq:Os09g0380200]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 06:19, 8 March 2017

The rice Os09g0380200 was reported as ylc1 in 2013 [1] by researchers from China.

Annotated Information

Figure 8. Subcellular localization of YLC1, ylc1 and truncated YLC1s in rice protoplasts..[1].

Gene Symbol

  • Os09g0380200 <=> OsYCL1,ylc1

Function

  • The Young Leaf Chlorosis 1 (YLC1) gene was isolated via map-based cloning and identified to encode a protein of unknown function belonging to the DUF3353 superfamily.
  • The riceOsYLC1 may be involved in Chl and lutein accumulation and chloroplast development at early leaf development in rice.

Phenotypic analysis

  • The researchers characterized a rice mutant named young leaf chlorosis 1 (ylc1) from a 60 Co-irradiated population.
  • Young leaves of the ylc1 mutant showed decreased levels of Chl and lutein compared to those of wild type, and transmission electron microscopy analysis revealed that the thylakoid lamellar structures were obviously loosely arranged.
  • Whereas, the mutant turns green gradually and approaches normal green at the maximum tillering stage.

Subcellular localization

  • Subcellular localization analysis in rice protoplasts demonstrated that the first 50 N-terminal amino acid residues are essential and sufficient for the protein localization to the chloroplast.

Labs working on this gene

  • National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University, Nanjing 210095, China
  • National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing 100081, China

References

  1. 1.0 1.1 Kunneng Zhou;Yulong Ren;Jia Lv;Yihua Wang;Feng Liu;Feng Zhou;Shaolu Zhao;Saihua Chen;Cheng Peng;Xin Zhang;Xiuping Guo;Zhijun Cheng;Jiulin Wang;Fuqing Wu;Ling Jiang;Jianmin Wan. Young Leaf Chlorosis 1, a chloroplast-localized gene required for chlorophyll and lutein accumulation during early leaf development in rice. Planta, 2013, 237(1): 279-292

Structured Information