Difference between revisions of "Os10g0127900"

From RiceWiki
Jump to: navigation, search
(Evolution)
 
(16 intermediate revisions by 4 users not shown)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
 
 
This study identified an F-box gene, designed OsFbx352, from rice, and characterized its function during seed germination by generating transgenic rice plants with overexpression and knockdown of OsFbx352. More specifically, this study evaluated the role of OsFbx352 in seed germination with emphasis on the interactions
 
This study identified an F-box gene, designed OsFbx352, from rice, and characterized its function during seed germination by generating transgenic rice plants with overexpression and knockdown of OsFbx352. More specifically, this study evaluated the role of OsFbx352 in seed germination with emphasis on the interactions
 
among ABA, OsFbx352, and glucose. The results reveal that OsFbx352 was involved in the regulation of glucose-induced delay of seed germination by modulating ABA metabolism.
 
among ABA, OsFbx352, and glucose. The results reveal that OsFbx352 was involved in the regulation of glucose-induced delay of seed germination by modulating ABA metabolism.
Line 9: Line 8:
 
===Expression===
 
===Expression===
 
1.OsFbx352 encodes a F-box domain protein and is suppressed by glucose
 
1.OsFbx352 encodes a F-box domain protein and is suppressed by glucose
A database search with the predicted polypeptide sequence showed that the F-box domain of OsFBX352 was related to those of the previously identified F-box proteins, including Arabidopsis SON (70% similarity), yeast CDC4 (65% similarity), rice OsDRF (67.5% similarity), and human SKP2 (57.5% similarity) (Fig. 1A). Phylogenetic analysis also revealed that OsFBX352 was closely related to Arabidopsis SON1 and UFO and to rice MAIF (Fig. 1B). These results suggest that OsFBX352 may be involved in the formation of E3 ubiquitin ligase complex.[[File:1.gif]]
+
A database search with the predicted polypeptide sequence showed that the F-box domain of OsFBX352 was related to those of the previously identified F-box proteins, including Arabidopsis SON (70% similarity), yeast CDC4 (65% similarity), rice OsDRF (67.5% similarity), and human SKP2 (57.5% similarity) (Fig. 1A). Phylogenetic analysis also revealed that OsFBX352 was closely related to Arabidopsis SON1 and UFO and to rice MAIF (Fig. 1B). These results suggest that OsFBX352 may be involved in the formation of E3 ubiquitin ligase complex.
 +
 
 +
 
 
Fig. 1. OsFbx352 contains a conserved F-box domain.(A) Alignment of the conserved F-box domain in OsFbx352 withother representative F-box-containing proteins: blue indicates residues identical to the OsFbx352 sequence; other colours indicate similar amino acids. The sequence at the bottom is the consensus sequence. (B)Phylogenetic tree analysis of the conserved F-box domain in OsFbx352 with other known F-box proteins from diverse organisms. Alignment and phylogenetic
 
Fig. 1. OsFbx352 contains a conserved F-box domain.(A) Alignment of the conserved F-box domain in OsFbx352 withother representative F-box-containing proteins: blue indicates residues identical to the OsFbx352 sequence; other colours indicate similar amino acids. The sequence at the bottom is the consensus sequence. (B)Phylogenetic tree analysis of the conserved F-box domain in OsFbx352 with other known F-box proteins from diverse organisms. Alignment and phylogenetic
 
analysis were performed using clustal x 2 and mega 5, respectively. Approximately 40 amino acids that constitute the
 
analysis were performed using clustal x 2 and mega 5, respectively. Approximately 40 amino acids that constitute the
Line 17: Line 18:
  
 
To characterize the function of OsFbx352, transgenic rice plants were generated by constructing a RNAi construct with part of the coding sequence fragment to knock down OsFbx352 expression, as well as an overexpression construct with the OsFbx352 full-length open reading frame driven by a maize ubiquitin promoter. Both constructs were introduced into rice calluses via Agrobacterium-mediated transformation. Several transgenic lines were obtained and subsequently confirmed
 
To characterize the function of OsFbx352, transgenic rice plants were generated by constructing a RNAi construct with part of the coding sequence fragment to knock down OsFbx352 expression, as well as an overexpression construct with the OsFbx352 full-length open reading frame driven by a maize ubiquitin promoter. Both constructs were introduced into rice calluses via Agrobacterium-mediated transformation. Several transgenic lines were obtained and subsequently confirmed
by qRT-PCR. The expression of OsFbx352 in the overexpression seeds was at least 11-fold higher than that in WT seeds, while OsFbx352 transcripts in seeds of the knockdown lines were reduced by approximately 70% compared with WT seeds (Fig. 2). Among the transgenic lines, two overexpression lines (OE10, OE24) and two knockdown lines (Ri15, Ri18) were selected to study the physiological function of OsFbx352 during seed germination.[[File:2.jpg]]
+
by qRT-PCR. The expression of OsFbx352 in the overexpression seeds was at least 11-fold higher than that in WT seeds, while OsFbx352 transcripts in seeds of the knockdown lines were reduced by approximately 70% compared with WT seeds (Fig. 2). Among the transgenic lines, two overexpression lines (OE10, OE24) and two knockdown lines (Ri15, Ri18) were selected to study the physiological function of OsFbx352 during seed germination.
 +
 
 +
 
 
Fig. 2. Quantitative real-time PCR analysis of OsFbx352 expression in wild-type (WT), overexpression (OE10, OE11, OE13, OE14, and OE24), and RNAi (Ri6, Ri15, and Ri18) plants. Data are mean ± SE for three replicates. Values above columns are the changes in gene expression relative to the WT.
 
Fig. 2. Quantitative real-time PCR analysis of OsFbx352 expression in wild-type (WT), overexpression (OE10, OE11, OE13, OE14, and OE24), and RNAi (Ri6, Ri15, and Ri18) plants. Data are mean ± SE for three replicates. Values above columns are the changes in gene expression relative to the WT.
 +
 +
3.Germination of transgenic seeds displayed different sensitivity to ABA
 +
Given that seed germination is sensitive to ABA and expression of OsFbx352 was strongly induced by ABA, the role of OsFbx352 played in seed germination was evaluated. There were no differences in seed germination among WT and transgenic lines in the control medium, and both WT and transgenic seeds were fully
 +
germinated after 4 days of incubation in the control medium (Fig. 3A). Germination of WT and RNAi4 seeds was delayed when ABA was present in the incubation medium, while germination of seeds with overexpressing OsFbx352 was relatively insensitive to ABA (Fig. 3B). In addition, the inhibitory effect of ABA
 +
on germination of RNAi seeds was more evident than that of WT seeds (Fig. 3B). For instance, both WT and transgenic seeds were germinated after 4 days in the control medium, while the germination rate for WT and RNAi seeds was reduced to approximately 80 and 60%, respectively, after the same period incubation in the
 +
presence of ABA (Fig. 3A, 3B). Moreover, the inhibitory effect of ABA on seed germination of WT and RNAi seeds was increased with an increase in ABA concentrations (Fig. 3C). In addition toseed germination, overexpression of OsFbx352 also rendered the seedlings less sensitive to ABA, as evidenced by longer shoot length of overexpression lines than the WT in the presence of ABA while suppression of OsFbx352 led to a shorter shoot length than the WT.
 +
 +
Fig. 3. OsFbx352-overexpressing seeds exhibited decreased sensitivity to exogenous abscisic acid (ABA). (A, B) Seeds of wild-type (WT), OE10, OE24, Ri15, and Ri18 lines were germinated in control medium (A) or 4 μM ABA (B) for 4 days. (C) Seed germination rate for WT and transgenic rice seeds after incubation in without and with different concentrations of ABA for 4 days. Data are mean ± SE for three replicates with each replicate containing 30 seeds. Statistically significant difference from the wild type within a treatment: *, P < 0.05; **, P < 0.01 (this figure is available in colour at JXB online).
 +
 +
4.Overexpression of OsFbx352 suppressed glucose-induced increase in seed ABA content
 +
 +
To investigate whether the altered sensitivity of seed germination in the OsFbx352-overexpressing and RNAi lines to glucose is related to ABA, changes in ABA contents in seeds of WT, overexpressing and RNAi lines were monitored during imbibition in the absence and presence of glucose. There were no differences in ABA contents in dry seeds among WT, overexpressing, and RNAi lines (Fig. 4). ABA contents in WT, overexpressing, and RNAi seeds were sharply reduced upon imbibition (Fig. 4). Moreover, ABA contents in the imbibed seeds were increased when glucose was present in the incubation medium, and the glucose-induced increase in ABA contents in the overexpressing seeds was significantly lower than in WT seeds, while ABA contents in the RNAi seeds were significantly higher than in WT seeds in the presence of glucose (Fig. 4). In contrast to glucose, addition of the same concentration of mannitol to the incubation medium had no effect on ABA levels in seeds of both WT and transgenic lines (Fig. 4), discounting the possibility that the glucose-induced increases in ABA levels in seeds are due to osmotic
 +
effect. These results suggest that overexpression of OsFbx352 disrupts glucose-dependent ABA metabolism, thus rendering the germination of overexpressing seeds less sensitive to glucose.
 +
 +
 +
 +
Fig. 4. Effects of water, mannitol, and glucose treatments on endogenous ABA contents in germinating seeds. Seeds were treated with water, mannitol, or glucose for 6 h at 28 °C and were subsequently collected for ABA quantification. Data are mean ± SE with three replicates. Data were statistically analysed with t-test. Statistically significant difference from the wild type within a treatment: *, P < 0.05; **, P < 0.01.
  
 
===Evolution===
 
===Evolution===
F-box proteins comprise one of the large protein families in plants. There are more than 692 and 779 F-box genes in the A. thaliana and rice genomes, respectively .Previous studies demonstrated that F-box proteins are involved in the regulation of several biological processes, including circadian clock, self-incompatibility, photomorphogenesis, floral meristem, phytohormonal signalling, and responses to abiotic stresses ; Dreher and Callis, 2007). For instance, the F-box protein TIR1/AFB can bind to the transcriptional repressor protein Aux/IAA, thus promoting their proteasomal degradation and activating auxin-induced transcription. The involvement of F-box proteins in response to both biotic and abiotic stresses has also been reported. For example, four F-box proteins from different species (DOR, OsDRF1, PvFBS1, and MAIF1) have been shown to act as key regulators in responses to biotic and abiotic stress; reported that an F-box protein, ZTL, is a major factor to control the period of circadian and early photomorphogenesis by regulating PRR5 for proteasome-dependent degradation. As a primary sugar, glucose
+
F-box proteins comprise one of the large protein families in plants. There are more than 692 and 779 F-box genes in the A. thaliana and rice genomes, respectively .Previous studies demonstrated that F-box proteins are involved in the regulation of several biological processes, including circadian clock, self-incompatibility, photomorphogenesis, floral meristem, phytohormonal signalling, and responses to abiotic stresses ; Dreher and Callis, 2007). For instance, the F-box protein TIR1/AFB can bind to the transcriptional repressor protein Aux/IAA, thus promoting their proteasomal degradation and activating auxin-induced transcription. The involvement of F-box proteins in response to both biotic and abiotic stresses has also been reported. For example, four F-box proteins from different species (DOR, OsDRF1, PvFBS1, and MAIF1) have been shown to act as key regulators in responses to biotic and abiotic stress; reported that an F-box protein, ZTL, is a major factor to control the period of circadian and early photomorphogenesis by regulating PRR5 for proteasome-dependent degradation. As a primary sugar, glucose modulates many important physiological processes ranging from seed germination to seedling development.
modulates many important physiological processes ranging from seed germination to seedling development
+
 
 +
It has been well documented that the inhibitory effect of sugaron seed germination is due to the increase in the active endogenous ABA level (Arenas-Huertero et . For example, Zhu et al. (2009) reported that a higher ABA content in imbibed seeds may account for the glucose-induced delay of rice seed germination. The present results showing that ABA contents were markedly increased in imbibed seeds of both WT and transgenic lines with altered expression of OsFbx352 when challenged with glucose are in line with those findings reported in the literature. In addition, this study found that the glucose-induced increase in ABA content in the
 +
OsFbx352-overexpressing seeds was lower than in WT seeds, while it was higher in the two RNAi seeds than in WT seeds. These results suggest that overexpression of OsFbx352 disrupts glucose-induced ABA metabolism, thus rendering the germination of overexpressing seeds less sensitive to glucose.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, the Chinese Academy of Sciences,Beijing 100093 PR China.
  
 
==References==
 
==References==
Please input cited references here.
+
1. Song, S., X. Dai, and W.H. Zhang, A rice F-box gene, OsFbx352, is involved in glucose-delayed seed germination in rice. J Exp Bot, 2012. 63(15): p. 5559-68.
 
 
==Structured Information==
 
{{JaponicaGene|
 
GeneName = Os10g0127900|
 
Description = Conserved hypothetical protein|
 
Version = NM_001070622.1 GI:115480987 GeneID:4348024|
 
Length = 8580 bp|
 
Definition = Oryza sativa Japonica Group Os10g0127900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
 
AP = Chromosome 10:1722588..1731167|
 
CDS = 1722947..1723168,1723268..1723423,1724688..1725077,1730916..1731026|
 
GCID = <gbrowseImage1>
 
name=NC_008403:1722588..1731167
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008403:1722588..1731167
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>ccgctggacatccagaaacgccgtcgagcaccttacgtcgccgccgtctgcccctgtcctgcaccgcgtcgagctccacttcgccgcgtttcgccatctcgccgtctcgcgggtttcttcgcacaacttgaagctggctgtccagcattggaagatctcttcttacatcaatgcggcgttcacgatgacgaaatctcctcccatacactgaaggttttgaccttcgatagtgtttttttctacatgccgatggacactgttgaattcaccttgctgaacaagacatctatttctcttccaagtgttacttctctgaccatatctactcccgagggtttcacacctatactaaaggacacggcatcagtagtgactgcatcagtatcagtatcagttacaatgtctagttttagatttcgttttgatgctaatgatctcggccagtatctccagagcctttccggtattacaaatttagagttcaactatcagggttcaaagttgacaatcgaaaaccatttgcaatggtgcccggaattcctcaatgttgtcaacctgactcttggtcaatggtgcctggattcaaacttctatgccctaattgtcttccttcagaactcacctagactacagaagctaactctgaaactcgaaaagagtaatatgagaataagtcgaagaatcattggcgagcttacggaaatatcgtttacatgcgagcaccttaatactgttgaagtgatatgctcggagaatgatccccaggtcatcactgtgcaagatttctttgttagcagtggcatgacctctgttcagtttcatatcaaacactggagcccgtacgcgaatgacctaccggcatttattcggtcgatatga</cdnaseq>|
 
AA = <aaseq>PLDIQKRRRAPYVAAVCPCPAPRRAPLRRVSPSRRLAGFFAQLE                    AGCPALEDLFLHQCGVHDDEISSHTLKVLTFDSVFFYMPMDTVEFTLLNKTSISLPSV                    TSLTISTPEGFTPILKDTASVVTASVSVSVTMSSFRFRFDANDLGQYLQSLSGITNLE                    FNYQGSKLTIENHLQWCPEFLNVVNLTLGQWCLDSNFYALIVFLQNSPRLQKLTLKLE                    KSNMRISRRIIGELTEISFTCEHLNTVEVICSENDPQVITVQDFFVSSGMTSVQFHIK                    HWSPYANDLPAFIRSI</aaseq>|
 
DNA = <dnaseqindica>8000..8221#7745..7900#6091..6480#142..252#tgcatttcatcgaacaccttgcgatcaccctctcaccaccgctagagatcaccattgtgaggctccccggccggagctggaggttggacggagtggaggaagagccgtgctgccgccgtcgccatgggggaagccgggtagccgctggacatccagaaacgccgtcgagcaccttacgtcgccgccgtctgcccctgtcctgcaccgcgtcgagctccacttcgccgcgtttcgccatctcgccgtctcgcggtacaccctcgcgcctgtagcgtcctccatacatctaattgctagcgccggctccaaaatcggcgattagcgcccatggccgtgccgccccggccgccgtttcgtcgccggcgagctctccgtgggtaggctatcccgggagctcccctctccatatagttcgtgaaatcgaatccccataccccgtagatgctcccgcacccttcaattcggccggaggatgtccctagcaccgaagccccttgtagccgagctcgggcatggcgtcgcctgatggcgccgcgcgcccccgtctcctcgcgcgccggctgccattggcgggagattgccggagctcctccgcgcctcaccccggccgtcgccgagccgcccgccgccgtcccggctcgggccggccacgccgactgcgccgagccgcgcctctgcatcgctcggtaacgggcgagaggaagaagaagatgaggagagagagaaaccgtgtgggacccacatgtgattagcgcacagtaatcctatccctaacggtgattatcccactcaatggcaggtggggtccctatagttaaaatctaagaaaacacaattatatattttgttcctatgacaggcgggacccaatggtaattaaacaagcaagtttgaccctaagtcaaccatgccggtcccacatgtcaaccacactgggttttggataatgtttccgattaaaaataaatcatttatgaacagtgcatttttacaatttctcggattaactcaaatttgaatctttaaattagtataacttattcattttagctccgattcgagtgaaacttgaacctaaattcatctaaattcataagctttccaatggtatataactcattatttaataaaatatattaatatcaaatgattagattatggtcaacttaaaaatgtgctaataaataaaattgatattgtacagtagagtagatgtcaaataaatatatttaacatgttttgtcactgtagcaaccacataatctaagtataagtgatgtctcaaatgaatggatgtataggaaaatactagtgcttatttaatattcgatggccatataattaaattcatgacttaaaaattagttacataaagtttagcttcatattttgtaactaaaatattaatactcatagataaatctttaacttgtttatgagaaataataacagagctgggtgtgatgaaatcaatcgaatgatagatttaaccagtgcaatatcctatatagtagtatatttataatttggttgacacctattatttaacatattatttaacagaacaataaataactcatgttcggtaaataatccaattaacatattattggacttgcatgtacagtacatccatttaacacatacacagtaagtcaatcacctactgttgcacctattaaactatgaattgtttgataaacatcaaagttagataaaaacactaattataaatctagacctcgttacgaggccacgtagacaaataatctgtacctataacctcacagatctatatagagcatggatgattattaacccttttataatttataatgacaagtaaaatatgatcgtgattaaaataatgccccattggtaaaataataatataaatgattcactgtaattatttgattgatcctaaatctatccaacaacggaacctctagtatatgaccattttatttagatagatgcatgtgtagacataatccttccatagccattagctagactaaaccaccatgacatcagaaagactaagaaaccttagctcttagcttgattagaatccattagcaaacgcaagtagtatgagcaaccctaggttcgacctcaacaattatattttgtttgcgcacattggattgttgtttgaacattgatttttctcgcgtattatagtattggtgtatcgattagtcgtgaggcaacgtatgcagcttccaggaggtgaacgttgatcaatattatatcaagaataagaactatcctaagcaggcaagtcatcaccccattccctgagcatgttgatcccaattgtgaaattgttttgtttacaaataaaattgcatgcagtgatgaatatcctacttgttgttatgccatgcctttgattattgcttatctcattattcccctgtacccataattatgtatgagtccctagtcacttatgacaaatgcttagtaatgctaatttagattcatgcattctcatatttatcaaatgctttatgcttgggaaactaccttggggaggtagttgagatacggcatgtggagacatgagtgccacattgccatgacattgatgagatgatttgtgaaagaaaatgaaaactgaacaaatgttttcgactagggcggctggaggacttgggtggtgtccggaaaaggctagtgccgtccctggttagttaaggaccgagccatgaagctaagcatgaaacgacccccgtacaaccgtacttctcgtatgggtatagacctagcagagtaaatagccgagcggaggtagtatccctgcatagtggttttcttgatgtgtgtgaggcagggcgtacggtggggcagccattggtaggaccacgaggggcaggtgcctacagtggtgtcgccatcggtaggactgccatatgtaaacctaaacttaactataacttaatgcatgtgtgagtcttcccttcccgggagagccagaactcctctcactgctagaaaccttggacgcctagagtgcatgaggactaaagttcatggagcgggtactgccaaagtgaggttattgaaaggctttgccatgacgcgtctcatgtgttgggatgaggctcatgtgttgggcagtcacggagtatgggtaaagtgtacttccactgcagtgtgagtaaaccaatctattcgaatagccgtgctcacggttattgagcaccgggacatgtattacacttggctagactctaaattcttaaaatgatgggtgggatgttgcatgatgattttgtactggtggaacaacttctcgagaggcgagaagaggtagaccccagaaaaccatgacgactagtggcgggaagctatccttgggaacacaatggatggtggacagaaccgtcgctgtttaatgaacaatggaattaaaacttgaccagtttatgctaggtcttaggtttgtgaaatgatatttgaaaactcagctttacgcaaagtaaccataaccactccttgtattatcctgtacattactgcatttttttgtggtggcttgctgagtacttttgtactcattgttgctctatatatatcttttagcagagtgttgaagagaagcccttgttagtacgcttgcgtacctaacaagatgatcggagtgtggttccattctaggtctcgttcccagtcgactgcttgtggcatgttaaccgggcccttgtattattttgtctttcgctgttgttctctgatagttatcggcctgcctggccctaatgtaagcatataactcttttagcctgaattcattcgtgatatgttgtgattcggctgtgtgtaccaactactgatccagggattggtactgataaacacagaagatttccgatttccaaaatcggggatcgacaattactaaatctaaatctatagttatgtaatacttcactttaaattagtagtcacgtgataaatttaatattaaacatgtagttttattatatatcatcttgaataaatatatagtcttgtaatagtttgatcataggtttattattttactcaaattttcaaaatgttaaaaaataagttccaacctaattgcataacttcatatcaaatcgctaaaagcaaaaaggaacacatggtatttgagcaagtactataaaatttctaaatactagtcataagataccaatcaagcttaaatggtaatatggaggagaggagagaagaaagaaatgagagtgaaatagagaagttaattggtgacaaatgcgttgaggttagtgtaatagaggtaatatattgtataggttatttttaaatttatgagaagatgacgtggataaaacttgcttgaaccaacttggggatggtgttttcaagcaggaatcctatctcgcgcagatgcgcgagcaaactaactcggatctactaggctcaccctaccctacactgcagttgttagcattttttttctctttttcgagtgatttcctctccttccgtcgttttcccgtgcaactttttgtctctcgtgattttttttctttttctcgcgcaattttttccttttttttttgcaagattattttttcccgtgtgctatcaggctaagtttcaacttcattttattttgaaaatttttgactcaaaatttaaaaacttctaacataaaattgaaaagttctaactcaaatttagaaattttcaactgaaaatttgaaaatttcgattaagatttgaaaactttcaactaagatttgaaactttcaatttaagatttgaaaaaattcaactcaaaattgaaaacttgcaaatcaaaatttgaaaactttcaaatctaatttgaaaactttaaagttaaaaattcaaaactttcaaatcaaatttgaaaactttcaactcaaaattttaaaaaaccatatccatttttttaaactttcaagtccaaatttaaaactctcagttcatcttttaaaattttaattcaaccagtctgttcgttattttgctataaataatcacgcttatgctaatctaatcgcgtttagcgctaagcgaggggaggggcgcgtctgcgtgtggcatggcgccgtgcgcgcgagttactgtagcagcgcggatgcgcgagttacgagagaagcggaaaactgaaaacgcgcgagatctcgcgtattactccttgtcacggacagtttgagagcgggaggcctcctcccaatctccccccttccccttccatagttccatggtggcgctcttcagacgcgagcgcgaggagcaccgggtccgcttgccggtggccggcctgactcgttagccgccgtcccgtccggggcgaaaggaagcatacctcgctcactccatttggaggtaatggcttcacccaatctttcttgaatcaccattcctctctggatggatgttcttcaccaaacaatgctgtattgccgctcaatgtagcatcgtttcttgcgctaagatcttgaatcttgcttggagttgagagctggggattcatggtttattgttccgttactgtgcagcttcccccatccgcacgcgcaccagctgttcgacgaaatgccaccgcgcgctctgcccccagtggaggacgacgccggcagggactggctcggtgacctccccgaggaggtcctccaccacatcatgtccttcctagacgcgcgccaggccgtgcgaacctgtgtgctgtcgcggcggtggcgcaacctctggcgtaccgtgccttgcatcaacgctgacttcgatgagtttgatctcgtcttttaccaaggggacgacgaggactatgatgacgtgctggcgttcaaaaggtttgttaaccgtctgctggagctccgcgatcccaccgccatgatagacaccttctggcttaggtacaccaccagaccagaaggaaacacgaattccaatgaagatgcctacgggtggattagccacgctttgcagaagcaggcccgggttttagaggttgtcgtgttctgctgcttatttgagctggaccactcggtgtttacttcctgctacctgagaagaattgcgttctccggtattgttttatgcaagggtttcttcgcacaacttgaagctggctgtccagcattggaagatctcttcttacatcaatgcggcgttcacgatgacgaaatctcctcccatacactgaaggttttgaccttcgatagtgtttttttctacatgccgatggacactgttgaattcaccttgctgaacaagacatctatttctcttccaagtgttacttctctgaccatatctactcccgagggtttcacacctatactaaaggacacggcatcagtagtgactgcatcagtatcagtatcagttacaatgtctagttttagatttcgttttgatgctaatgatctcggccagtatctccagagcctttccggtattacaaatttagagttcaactatcagggttcaaaggtatgcatatttctattacatagtatgcatctttatttaggtgtcaatttgaaaaacttaaagttaagcatggtgttgtttcttcttgctacttcataattgcaattgtttaattacctgtacctgcaaaacttatgggcattgtttggataatgggatagggaaatgatttcccaactatcaaaaggtatctttaaatcctaaccatttattctccctcttccatttaatcctaacccttcattcatttcctaatcccaatcccacccttcatttcccattatccaaacacacccatgattcaagtgatcattttgtcgtgaaatcatgatgtgttgatacgatgaccactgatgttatcaaccactcaatgcaatatagttcatccactccagccattttttgtacacaaatcaatccgttgaacacttgtcctgctgtttctttgttggtagttttatctcaaaatgaaactggatcatttctcatgtgaggactagaatgttctagtctggatgcaatatcagggctgccaaccaaatgtgcatcttgtttgacatctgactgattattttagttgacatcagttcacatcttaccttactttttgaaagagggggttagcggtgagctggtgattgtaggttctagacccaaccctagtccagatttttcttggctgcagacatgtatgcattttatttctaagatatttatagaaaacaatattgcaattgcatatgcggccatttggtattgtgtaatcatgcatgaaatcgttggtttccggattaattatttattgcattttatattttagacagtatgttgaattgggatatgatgcaacgcacagacattatgcatttatgctacataaatttgaaaattaagagacattcgaaggcaatatgcaaacagaaagtgcttcaggattagttgaaaatctcacttctagtgcttcatcatgaaatatttgtactgttctttttactagtttttgttacatgacttgcatggaaagtatcctagcagtaagttaacatgcctgagactcgcattgaaaatatgaacatgtataatattgtttagtctggtcttttgttgacataatttcagtttctcctgtggtcttttaccatccgttatcctaaagttgaagctattatacatgcactccaaatagaattctttatcacatattgttaatgctctcaatttagttgccatattttctgattatattcatttgaatctttcgaagttgacaatcgaaaaccatttgcaatggtgcccggaattcctcaatgttgtcaacctgactcttggtcaatggtgcctggattcaaacttctatgccctaattgtcttccttcagaactcacctagactacagaagctaactctgaaactcgaaaaggtaaatgctttcgtccaaatgtgcactgatcctacttgattgctttttacacaagagttttcacatcgggatatagatcacctgtttttgttgctgtagagtaatatgagaataagtcgaagaatcattggcgagcttacggaaatatcgtttacatgcgagcaccttaatactgttgaagtgatatgctcggagaatgatccccaggtcatcactgtgcaagatttctttgttagcagtggcatgacctctgttcagtttcatatcaaacactggagcccgtacgcgaatgacctaccggcatttattcggtcgatatgaaatggcaaaggatcacgaattagtttgccatcccattgaagaaaatcactctctttcgcctgtcggctacatctgctggttacagtagagtgttcagtgatcttgtttggtgctttctgctatgacgtgaaggtgagtagaaacaattgcatcttgccttgcatgtaaggtcagtggtattgtacttgtttgctgcgatcacatgatgatttgtagcaataatgatgctccaagaaaaatactgtatggctatggcgtctcctgatacagcctgccactgctttctcaacttggctggtctccggtgaaacgtattgtatttgtctctctcctaatataatcccatgttatagtgttgt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070622.1 RefSeq:Os10g0127900]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]
Line 68: Line 58:
 
[[Category:Japonica Chromosome 10]]
 
[[Category:Japonica Chromosome 10]]
 
[[Category:Chromosome 10]]
 
[[Category:Chromosome 10]]
 +
== Structured Information ==

Latest revision as of 06:32, 8 March 2017

Please input one-sentence summary here.

Annotated Information

Function

This study identified an F-box gene, designed OsFbx352, from rice, and characterized its function during seed germination by generating transgenic rice plants with overexpression and knockdown of OsFbx352. More specifically, this study evaluated the role of OsFbx352 in seed germination with emphasis on the interactions among ABA, OsFbx352, and glucose. The results reveal that OsFbx352 was involved in the regulation of glucose-induced delay of seed germination by modulating ABA metabolism.

Expression

1.OsFbx352 encodes a F-box domain protein and is suppressed by glucose A database search with the predicted polypeptide sequence showed that the F-box domain of OsFBX352 was related to those of the previously identified F-box proteins, including Arabidopsis SON (70% similarity), yeast CDC4 (65% similarity), rice OsDRF (67.5% similarity), and human SKP2 (57.5% similarity) (Fig. 1A). Phylogenetic analysis also revealed that OsFBX352 was closely related to Arabidopsis SON1 and UFO and to rice MAIF (Fig. 1B). These results suggest that OsFBX352 may be involved in the formation of E3 ubiquitin ligase complex.


Fig. 1. OsFbx352 contains a conserved F-box domain.(A) Alignment of the conserved F-box domain in OsFbx352 withother representative F-box-containing proteins: blue indicates residues identical to the OsFbx352 sequence; other colours indicate similar amino acids. The sequence at the bottom is the consensus sequence. (B)Phylogenetic tree analysis of the conserved F-box domain in OsFbx352 with other known F-box proteins from diverse organisms. Alignment and phylogenetic analysis were performed using clustal x 2 and mega 5, respectively. Approximately 40 amino acids that constitute the F-box motif in OsFBX352 were aligned with comparable regions from reported F-box proteins in humans (SKP2, BAB87202.1), yeast (CDC4, NP_116585.1), Arabidopsis (COI1, NP_565919; SON1, NP_179323; UFO, NP_564368.1; TIR1, NP_567135.1), and rice (OsMAIF, NP_001047698.1; OsDRF, NP_001052823.1).

2.Generation of transgenic rice plants with altered expression of OsFbx352

To characterize the function of OsFbx352, transgenic rice plants were generated by constructing a RNAi construct with part of the coding sequence fragment to knock down OsFbx352 expression, as well as an overexpression construct with the OsFbx352 full-length open reading frame driven by a maize ubiquitin promoter. Both constructs were introduced into rice calluses via Agrobacterium-mediated transformation. Several transgenic lines were obtained and subsequently confirmed by qRT-PCR. The expression of OsFbx352 in the overexpression seeds was at least 11-fold higher than that in WT seeds, while OsFbx352 transcripts in seeds of the knockdown lines were reduced by approximately 70% compared with WT seeds (Fig. 2). Among the transgenic lines, two overexpression lines (OE10, OE24) and two knockdown lines (Ri15, Ri18) were selected to study the physiological function of OsFbx352 during seed germination.


Fig. 2. Quantitative real-time PCR analysis of OsFbx352 expression in wild-type (WT), overexpression (OE10, OE11, OE13, OE14, and OE24), and RNAi (Ri6, Ri15, and Ri18) plants. Data are mean ± SE for three replicates. Values above columns are the changes in gene expression relative to the WT.

3.Germination of transgenic seeds displayed different sensitivity to ABA Given that seed germination is sensitive to ABA and expression of OsFbx352 was strongly induced by ABA, the role of OsFbx352 played in seed germination was evaluated. There were no differences in seed germination among WT and transgenic lines in the control medium, and both WT and transgenic seeds were fully germinated after 4 days of incubation in the control medium (Fig. 3A). Germination of WT and RNAi4 seeds was delayed when ABA was present in the incubation medium, while germination of seeds with overexpressing OsFbx352 was relatively insensitive to ABA (Fig. 3B). In addition, the inhibitory effect of ABA on germination of RNAi seeds was more evident than that of WT seeds (Fig. 3B). For instance, both WT and transgenic seeds were germinated after 4 days in the control medium, while the germination rate for WT and RNAi seeds was reduced to approximately 80 and 60%, respectively, after the same period incubation in the presence of ABA (Fig. 3A, 3B). Moreover, the inhibitory effect of ABA on seed germination of WT and RNAi seeds was increased with an increase in ABA concentrations (Fig. 3C). In addition toseed germination, overexpression of OsFbx352 also rendered the seedlings less sensitive to ABA, as evidenced by longer shoot length of overexpression lines than the WT in the presence of ABA while suppression of OsFbx352 led to a shorter shoot length than the WT.

Fig. 3. OsFbx352-overexpressing seeds exhibited decreased sensitivity to exogenous abscisic acid (ABA). (A, B) Seeds of wild-type (WT), OE10, OE24, Ri15, and Ri18 lines were germinated in control medium (A) or 4 μM ABA (B) for 4 days. (C) Seed germination rate for WT and transgenic rice seeds after incubation in without and with different concentrations of ABA for 4 days. Data are mean ± SE for three replicates with each replicate containing 30 seeds. Statistically significant difference from the wild type within a treatment: *, P < 0.05; **, P < 0.01 (this figure is available in colour at JXB online).

4.Overexpression of OsFbx352 suppressed glucose-induced increase in seed ABA content

To investigate whether the altered sensitivity of seed germination in the OsFbx352-overexpressing and RNAi lines to glucose is related to ABA, changes in ABA contents in seeds of WT, overexpressing and RNAi lines were monitored during imbibition in the absence and presence of glucose. There were no differences in ABA contents in dry seeds among WT, overexpressing, and RNAi lines (Fig. 4). ABA contents in WT, overexpressing, and RNAi seeds were sharply reduced upon imbibition (Fig. 4). Moreover, ABA contents in the imbibed seeds were increased when glucose was present in the incubation medium, and the glucose-induced increase in ABA contents in the overexpressing seeds was significantly lower than in WT seeds, while ABA contents in the RNAi seeds were significantly higher than in WT seeds in the presence of glucose (Fig. 4). In contrast to glucose, addition of the same concentration of mannitol to the incubation medium had no effect on ABA levels in seeds of both WT and transgenic lines (Fig. 4), discounting the possibility that the glucose-induced increases in ABA levels in seeds are due to osmotic effect. These results suggest that overexpression of OsFbx352 disrupts glucose-dependent ABA metabolism, thus rendering the germination of overexpressing seeds less sensitive to glucose.


Fig. 4. Effects of water, mannitol, and glucose treatments on endogenous ABA contents in germinating seeds. Seeds were treated with water, mannitol, or glucose for 6 h at 28 °C and were subsequently collected for ABA quantification. Data are mean ± SE with three replicates. Data were statistically analysed with t-test. Statistically significant difference from the wild type within a treatment: *, P < 0.05; **, P < 0.01.

Evolution

F-box proteins comprise one of the large protein families in plants. There are more than 692 and 779 F-box genes in the A. thaliana and rice genomes, respectively .Previous studies demonstrated that F-box proteins are involved in the regulation of several biological processes, including circadian clock, self-incompatibility, photomorphogenesis, floral meristem, phytohormonal signalling, and responses to abiotic stresses ; Dreher and Callis, 2007). For instance, the F-box protein TIR1/AFB can bind to the transcriptional repressor protein Aux/IAA, thus promoting their proteasomal degradation and activating auxin-induced transcription. The involvement of F-box proteins in response to both biotic and abiotic stresses has also been reported. For example, four F-box proteins from different species (DOR, OsDRF1, PvFBS1, and MAIF1) have been shown to act as key regulators in responses to biotic and abiotic stress; reported that an F-box protein, ZTL, is a major factor to control the period of circadian and early photomorphogenesis by regulating PRR5 for proteasome-dependent degradation. As a primary sugar, glucose modulates many important physiological processes ranging from seed germination to seedling development.

It has been well documented that the inhibitory effect of sugaron seed germination is due to the increase in the active endogenous ABA level (Arenas-Huertero et . For example, Zhu et al. (2009) reported that a higher ABA content in imbibed seeds may account for the glucose-induced delay of rice seed germination. The present results showing that ABA contents were markedly increased in imbibed seeds of both WT and transgenic lines with altered expression of OsFbx352 when challenged with glucose are in line with those findings reported in the literature. In addition, this study found that the glucose-induced increase in ABA content in the OsFbx352-overexpressing seeds was lower than in WT seeds, while it was higher in the two RNAi seeds than in WT seeds. These results suggest that overexpression of OsFbx352 disrupts glucose-induced ABA metabolism, thus rendering the germination of overexpressing seeds less sensitive to glucose.

Labs working on this gene

State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, the Chinese Academy of Sciences,Beijing 100093 PR China.

References

1. Song, S., X. Dai, and W.H. Zhang, A rice F-box gene, OsFbx352, is involved in glucose-delayed seed germination in rice. J Exp Bot, 2012. 63(15): p. 5559-68.

Structured Information