Difference between revisions of "Os08g0531600"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
 
(5 intermediate revisions by 3 users not shown)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
 +
qGW8 within a genetic window on the long arm of chromosome 8 defined by the markers RM80 and RM447.The progeny testing of homozygous recombinant plants allowed this region to be narrowed to an ~7.5-kb stretch flanked by RM502 and PSM711.Quantitative trait locus GW8 is synonymous with OsSPL16, which encodes a protein that is a positive regulator of cell proliferation.Higher expression of this gene promotes cell division and grain filling, with positive consequences for grain width and yield in rice. Conversely, a loss-of-function mutation in Basmati rice is associated with the formation of a more slender grain and better quality of appearance. The correlation between grain size and allelic variation at the GW8 locus suggests that mutations within the promoter region were likely selected in rice breeding programs. We also show that a marker-assisted strategy targeted at elite alleles of GS3 and OsSPL16 underlying grain size and shape can be effectively used to simultaneously improve grain quality and yield.
 
===Function===
 
===Function===
 
[[File:Parental grains.jpg|frame|'''Figure1'''  Parental grains. Scale bar, 3 mm.]]
 
[[File:Parental grains.jpg|frame|'''Figure1'''  Parental grains. Scale bar, 3 mm.]]
  
 
'''''OsSPL16''''' control of grain size, shape, and quality<ref name="ref1" />.
 
'''''OsSPL16''''' control of grain size, shape, and quality<ref name="ref1" />.
'''''OsSPL16''''' encodes a protein that is a positive regulator of cell proliferation. Higher expression of this gene promotes cell division and grain filling, with positive consequences for grain width and yield in rice. The candidate gene ''''''OsSPL16'''''' encodes squamosa promoter-binding protein-like 16, which belongs to the SBP domain family of transcription factors and shares homology with the product of '''''tga1''''',a domestication syndrome gene associated with the formation of grains in maize<ref name="ref1" />. Grain width and length were also altered in NIL-'''''qw8''''' plaints expressing the Basmati385 '''''OsSPL16''''' cDNA under the control of the native HJX74 promoter.
+
'''''OsSPL16''''' encodes a protein that is a positive regulator of cell proliferation. OsSPL16contributes to organ size through its effect on the cell cycle machinery.Higher expression of this gene promotes cell division and grain filling, with positive consequences for grain width and yield in rice. The candidate gene ''''''OsSPL16'''''' encodes squamosa promoter-binding protein-like 16, which belongs to the SBP domain family of transcription factors and shares homology with the product of '''''tga1''''',a domestication syndrome gene associated with the formation of grains in maize<ref name="ref1" />. Grain width and length were also altered in NIL-'''''qw8''''' plaints expressing the Basmati385 '''''OsSPL16''''' cDNA under the control of the native HJX74 promoter.The SPL genes have an important role in the control of flowering.The  SPL  genes  have  been  shown  to  be  regulated  by  microRNA miR156 (refs. 14–16,19–22), and OsSPL16contains an OsmiR156 target sequence. OsSPL16functions as a negative regulator of panicle branching.
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  
 
===Mutation===
 
===Mutation===
 
+
Higher expression of this gene promotes cell division and grain filling, with positive consequences for grain width and yield in rice.A loss-of-function mutation in Basmati rice is assciated with the formation of a more slender grain and better quality of apperance. The correlation between grain size and allelic variation at the GW8 locus suggests that mutations within the promoter region were likely selected in rice breeding programs<ref name="ref1" />.
A loss-of-function mutation in Basmati rice is assciated with the formation of a more slender grain and better quality of apperance. The correlation between grain size and allelic variation at the GW8 locus suggests that mutations within the promoter region were likely selected in rice breeding programs<ref name="ref1" />.
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  
 
===Expression===
 
===Expression===
 
[[File: Expression of OsSPL16in NIL-GW8and NIL-gw8.jpg|frame|'''Figure2'''  Expression of OsSPL16in NIL-GW8and NIL-gw8.R, root; C, culm; L, leaf blade; SAM, shoot apex meristem; BM, branch meristem; YP1–Y22, young panicles, where the number indicates the length of the panicle in centimeters. Expression levels are shown as relative number of copies per 1,000 copies of rice actin3. Data are given as mean ±s.e.m. (n= 4).]]
 
[[File: Expression of OsSPL16in NIL-GW8and NIL-gw8.jpg|frame|'''Figure2'''  Expression of OsSPL16in NIL-GW8and NIL-gw8.R, root; C, culm; L, leaf blade; SAM, shoot apex meristem; BM, branch meristem; YP1–Y22, young panicles, where the number indicates the length of the panicle in centimeters. Expression levels are shown as relative number of copies per 1,000 copies of rice actin3. Data are given as mean ±s.e.m. (n= 4).]]
 
The expression profiles of OsSPL16in various organs of HJX74 were  examined  by  quantitative  RT-PCR  analysis. OsSPL16 was preferentially expressed in developing panicles, and the highest levels of OsSPL16expression were found in panicles of 7 cm in length, whereas there was less transcript accumulation in the root, culm, leaf sheath, shoot meristem and young panicle(of <1 cm in length)<ref name="ref1 " />
 
The expression profiles of OsSPL16in various organs of HJX74 were  examined  by  quantitative  RT-PCR  analysis. OsSPL16 was preferentially expressed in developing panicles, and the highest levels of OsSPL16expression were found in panicles of 7 cm in length, whereas there was less transcript accumulation in the root, culm, leaf sheath, shoot meristem and young panicle(of <1 cm in length)<ref name="ref1 " />
 
 
 
 
 
 
 
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
 
 
 
 
 
 
 
 
 
 
===Structured information===
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
The State Key Laboratory of Plant Cell and Chromosome Engineering, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, National
 +
Centre for Plant Gene Research, Beijing, China.
 +
The State Key Laboratory for Conservation and Utilization of Subtropical Agro-bioresources, South China Agricultural
 +
University, Guangzhou, China.
 +
The State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou, China.
 +
working
 +
Development of the SSSL population.Fine mapping of qGW8.Transgene constructs.Expression analysis.Histological analysis.Transactivation activity assay.Analysis  of  transgenic  plants  expressing  OsSPL16.
  
 
==References==
 
==References==
Line 68: Line 32:
 
Wang S, Wu K, Yuan Q, et al. Control of grain size, shape and quality by OsSPL16 in rice[J]. Nature genetics, 2012, 44(8): 950-954.
 
Wang S, Wu K, Yuan Q, et al. Control of grain size, shape and quality by OsSPL16 in rice[J]. Nature genetics, 2012, 44(8): 950-954.
 
</ref>
 
</ref>
 
+
</references>
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os08g0531600|
 
Description = Similar to Squamosa-promoter binding-like protein 3|
 
Version = NM_001068869.1 GI:115477476 GeneID:4346133|
 
Length = 5032 bp|
 
Definition = Oryza sativa Japonica Group Os08g0531600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|
 
AP = Chromosome 8:26589172..26594203|
 
CDS = 26589228..26589718,26592621..26592751,26593194..26593939|
 
GCID = <gbrowseImage1>
 
name=NC_008401:26589172..26594203
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008401:26589172..26594203
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggagtgggatctcaagatgccgccggcggcgagctgggagctagccgacgagctggagaacagcggcggcgggggtgtaccggcggcggtatcgtcgtcatcggctgcggttggtggcggcgtcaatgcggggggtggtggcaggcaggagtgctcggtcgacctcaagctcggcgggttgggggagttcggcggcggcggcgcgcagccgcgggtcgccgtggcgggcgagccggccaaggggaaggggccagcggccgccgccacgggagcagcagcagcagcgtcgtcggcgccggcgaagcggccgcgcggtgcggcggcggcggggcagcagcagtgcccgtcgtgcgcggtggacgggtgcaaggaggacctgagcaagtgccgcgactaccatcgccggcacaaggtgtgcgaggcccactccaagacccccctcgtcgtcgtctccggccgcgagatgcgcttctgccagcagtgcagcaggtttcacttgcttcaggagtttgatgaggccaagcgcagctgtagaaagcgactagatgggcacaaccgtcgccgcaggaagccacagccagatcccatgaactctgcaagttatcttgcaagccaacaaggggcaagattctcaccgttcgcgacgccgagaccggaggcaagctggacagggatgatcaaaaccgaggagagcccatactacacgcaccaccaaatccctcttggcatcagcagcaggcagcagcatttcgttggctccacctctgacggcggccgccgcttccctttcctccaggaaggcgagatcagcttcggcaccggcgccggcgccggcggcgtgccaatggatcaggcagcagctgctgctgctgcttcagtgtgccagccacttctgaagacggtagctcctcctcctcctcctcatggcggcggcggcagcggcggcggcaagatgttctccgatggtgggttgacacaagtgctcgactccgattgtgctctctctcttctgtcagctccggcgaactccacggccatcgacgtcggcggtggccgggtggtcgtccagccgaccgagcacatccccatggcgcagcctctcatctctggccttcagttcggcggcggcggcggcagctcagcctggttcgcggcgcggccgcatcatcaggcggccaccggcgccgccgccaccgccgtcgtcgtctcgacggccggtttctcctgcccggtggtggagagcgagcagctgaacacagtcctgagctccaatgacaatgagatgaactacaatgggatgtttcacgtcggcggcgaaggctcatcggatggcacgtcgtcgtctctgccgttctcatggcagtag</cdnaseq>|
 
AA = <aaseq>MEWDLKMPPAASWELADELENSGGGGVPAAVSSSSAAVGGGVNA                    GGGGRQECSVDLKLGGLGEFGGGGAQPRVAVAGEPAKGKGPAAAATGAAAAASSAPAK                    RPRGAAAAGQQQCPSCAVDGCKEDLSKCRDYHRRHKVCEAHSKTPLVVVSGREMRFCQ                    QCSRFHLLQEFDEAKRSCRKRLDGHNRRRRKPQPDPMNSASYLASQQGARFSPFATPR                    PEASWTGMIKTEESPYYTHHQIPLGISSRQQHFVGSTSDGGRRFPFLQEGEISFGTGA                    GAGGVPMDQAAAAAAASVCQPLLKTVAPPPPPHGGGGSGGGKMFSDGGLTQVLDSDCA                    LSLLSAPANSTAIDVGGGRVVVQPTEHIPMAQPLISGLQFGGGGGSSAWFAARPHHQA                    ATGAAATAVVVSTAGFSCPVVESEQLNTVLSSNDNEMNYNGMFHVGGEGSSDGTSSSL                    PFSWQ</aaseq>|
 
DNA = <dnaseqindica>57..547#3450..3580#4023..4768#acagctcaagcttacgcgggagctaagctgagctacagcgagcggcggcggcggccatggagtgggatctcaagatgccgccggcggcgagctgggagctagccgacgagctggagaacagcggcggcgggggtgtaccggcggcggtatcgtcgtcatcggctgcggttggtggcggcgtcaatgcggggggtggtggcaggcaggagtgctcggtcgacctcaagctcggcgggttgggggagttcggcggcggcggcgcgcagccgcgggtcgccgtggcgggcgagccggccaaggggaaggggccagcggccgccgccacgggagcagcagcagcagcgtcgtcggcgccggcgaagcggccgcgcggtgcggcggcggcggggcagcagcagtgcccgtcgtgcgcggtggacgggtgcaaggaggacctgagcaagtgccgcgactaccatcgccggcacaaggtgtgcgaggcccactccaagacccccctcgtcgtcgtctccggccgcgagatgcgcttctgccagcagtgcagcaggtaaccccccccccccccccccaaccattgtctccttccttcccgccaaattcactgcaaaacaaaaaaaaaatcgtagcccaaaacaccccaagacgtcatggcaattcgcatcaagaactgcatatatcaatttctccacttcttttcagcgtcactgtctctgatcattctctttgctgaacaaaagaaaaagaagataagcaagagtttttctcttttttttgctccttttttttttggctttgcacaatctcttcttgcttccagttgcaactgaccattgtgcagtacatgcatctgcatctactgattctaatttctacgctacttcggatcaaaattaattcagtactgcaaagcacaatttcattgatccatttcatccagcctcggactttgttcatcatcatctatctgtctcttacttcctttccattgggagcatactatccggctgtctcgtttcagggacgcacagctttgcctttaatggcatgccttttcagccttccctcatgctatcctttagctcggcaactcgtattaccccaaattattacctctttgctcgcctttagatttattactatcatcttttcttttcttttttatatctcttcttcaccagtagctgcactgtttttgcactgctcaagagcaaagcagctgctgtagttgttcagtgtttgttgcttactgagaaaaaaaagtgatagagacagaaaaaaaagtgagggagagaaaaaaaaaaaaacagaactgacgcctgaatctcatcagccagagatcacattaggcaatttaccaccagactgttatgatattattttcagtgtcctcctgtctgaatatgaccgtctgcttcctctaacaagaacaataaatcagcacctagttcagtactaactaattttctcatgaataaataaataaatatagtcactgtaattagtgacactactagcacggtagcacctggtttagtggttaacaatacttggttcttgcacttctccctgtcgatgttttttcgcgtgggggctagctatcgattgattgattcctcaactatggcatcgaaactggaagaacatatgcatactgggacacacaccctgcttgctttctgaatttctgatttctcctcaaggcagctggcctaccacatatatctgactgagctgtgctgcttcttgccatgagagctaagctaccttagcttagctactactaccacttactacgccgtctgttttggaagggaaaggcagatgtggatgcccaaacctagaaagatggttgtaccactgaaagagagagtttgtggatgtgatctgcactaaagcacccctgtacagggaaaggaccatgtagccctactacaagttcaccatttacacctctgttcctaaggttgggccacacatatatgaagcttttaatgtctcggtttgttggaaagggttttgcattgccattacaagccagcacagtggatacagatagccagggtgctctctattggagaagaaaaaaaatggagccctgaacaccctgattggatctcactattgcatgaaagaatgatgagatttcttgtcttataatttttaaagattttttttctaaagtcagtcttagttacattcatttgttatattccagtttcagacttattggtactaggttctgtgagatctttttttttttttacatcgtttgagtatcatagggtgattcagtaccaccttgacccctgtttttatcagagctctaaacttctaacaccacttctaacttttgagctagtcttctaaccttgctgttttctgaacaaagatgtatactcaagattggtcatagatggagatattctgtgaacagaactaacataatagcaccaaattagtcagacatactctttacaaaattactttggagtttgttgtccactccttgaactagtacaatattgtcctactgaatgccttcctgcctttcaacttgaaagttccctattttatctgttagttcttttataaaatgtaactgcacattgtcagaaggatttgcatcttatttcactttgcgccagttttaagtaatacatggtatattggcataagaccagactctaccattttttatcttgcagagacatagcaaacaactaagtactttttattgtggtgtgctcctttacacagtagcacaacttgtaggatgcttatgtgattgtctcatcaattattctctttatctttaaaaagagaatgatacaaaaaatctctttatctgagaatacacattacccagtggggacagtctttcaatgatttgattacttcgtcagtgtttgcaaactgggaagatcattatgctgctgcatgcagactttataaattaagtgatcttcagagtcagaacaagatgttagctttctatacctatggatccacatccactgtattgtggtccatgtacaagtggggttaaaatatttttctgccgttgacagaacttcagttcaataaatttatctaagatgaagtatccaagcacggaaagagctaattaactgatgaaattcctgtggtcccttgtgttggtatatgagtattctaagagagaatatggagacagtatattaaattattctgagaatacttatcctgacgtttctttagtgagaactgtggtgcatcgttacaaaacttcagatcatgtttcaggagtattttatcatgtaagaattttaaaaagacgtacatcctaggtacagtcatttcttaaggtttcatggtactgaatgattaaattacttcttctggattgggtttcaagcatcatttggctaatttcaatgcagttaaatgatcataagcttttctttcttcaggtttcacttgcttcaggagtttgatgaggccaagcgcagctgtagaaagcgactagatgggcacaaccgtcgccgcaggaagccacagccagatcccatgaactctgcaagttatcttgcaagccaacaaggtattttcttgtttattattaccactctatgatatcgcagttcatataagattaactgggatatagtcattcagacttcctaactattgttagactaggaaaaaaactatgaaacatgctaatagcatagataagtcatggtaaaaaaaaagtaaaagaaaatgaaactgtggttaaaaaaaaacgcaaatattagggaatgacctaatatcaaataattagaaggagtgaggcttcgaacccaggtcgtctagcccatcaccttttgaagctagccagaaaacccctgggcgtttctcagaactgtggttcagctatgactctgttctttcaatcctgacatcttgtaacatgtaatgcattctagtatacatctaatgcattgaaccatatcttatgtactaatttgtgctgatatatcaaacatcgcatcaaaattcaggggcaagattctcaccgttcgcgacgccgagaccggaggcaagctggacagggatgatcaaaaccgaggagagcccatactacacgcaccaccaaatccctcttggcatcagcagcaggcagcagcatttcgttggctccacctctgacggcggccgccgcttccctttcctccaggaaggcgagatcagcttcggcaccggcgccggcgccggcggcgtgccaatggatcaggcagcagctgctgctgctgcttcagtgtgccagccacttctgaagacggtagctcctcctcctcctcctcatggcggcggcggcagcggcggcggcaagatgttctccgatggtgggttgacacaagtgctcgactccgattgtgctctctctcttctgtcagctccggcgaactccacggccatcgacgtcggcggtggccgggtggtcgtccagccgaccgagcacatccccatggcgcagcctctcatctctggccttcagttcggcggcggcggcggcagctcagcctggttcgcggcgcggccgcatcatcaggcggccaccggcgccgccgccaccgccgtcgtcgtctcgacggccggtttctcctgcccggtggtggagagcgagcagctgaacacagtcctgagctccaatgacaatgagatgaactacaatgggatgtttcacgtcggcggcgaaggctcatcggatggcacgtcgtcgtctctgccgttctcatggcagtagttttttcagtaactgtatgttgctgccttagtttcagtagagttggttcttcatttcttttcagtgatcaaattattgtttctgttcttttctgccatggtaagttccttttttttttcttcttcttgccttcatttgagttaattacagcattgatttgtgtgaacaaaattcatcataaatcagttcctcgcgagatcattggtctcaacatgatggtgccaagtgagaactgcagtattgtgcagttttcagttttgagtc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001068869.1 RefSeq:Os08g0531600]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:38, 21 March 2017

Os08g0531600(OsSPL16) is a very important gene that encoding a positive regulator of cell prolifertion which can pormote cell division and grain filling.

Annotated Information

qGW8 within a genetic window on the long arm of chromosome 8 defined by the markers RM80 and RM447.The progeny testing of homozygous recombinant plants allowed this region to be narrowed to an ~7.5-kb stretch flanked by RM502 and PSM711.Quantitative trait locus GW8 is synonymous with OsSPL16, which encodes a protein that is a positive regulator of cell proliferation.Higher expression of this gene promotes cell division and grain filling, with positive consequences for grain width and yield in rice. Conversely, a loss-of-function mutation in Basmati rice is associated with the formation of a more slender grain and better quality of appearance. The correlation between grain size and allelic variation at the GW8 locus suggests that mutations within the promoter region were likely selected in rice breeding programs. We also show that a marker-assisted strategy targeted at elite alleles of GS3 and OsSPL16 underlying grain size and shape can be effectively used to simultaneously improve grain quality and yield.

Function

Figure1 Parental grains. Scale bar, 3 mm.

OsSPL16 control of grain size, shape, and quality[1]. OsSPL16 encodes a protein that is a positive regulator of cell proliferation. OsSPL16contributes to organ size through its effect on the cell cycle machinery.Higher expression of this gene promotes cell division and grain filling, with positive consequences for grain width and yield in rice. The candidate gene 'OsSPL16' encodes squamosa promoter-binding protein-like 16, which belongs to the SBP domain family of transcription factors and shares homology with the product of tga1,a domestication syndrome gene associated with the formation of grains in maize[1]. Grain width and length were also altered in NIL-qw8 plaints expressing the Basmati385 OsSPL16 cDNA under the control of the native HJX74 promoter.The SPL genes have an important role in the control of flowering.The SPL genes have been shown to be regulated by microRNA miR156 (refs. 14–16,19–22), and OsSPL16contains an OsmiR156 target sequence. OsSPL16functions as a negative regulator of panicle branching.

Mutation

Higher expression of this gene promotes cell division and grain filling, with positive consequences for grain width and yield in rice.A loss-of-function mutation in Basmati rice is assciated with the formation of a more slender grain and better quality of apperance. The correlation between grain size and allelic variation at the GW8 locus suggests that mutations within the promoter region were likely selected in rice breeding programs[1].

Expression

Figure2 Expression of OsSPL16in NIL-GW8and NIL-gw8.R, root; C, culm; L, leaf blade; SAM, shoot apex meristem; BM, branch meristem; YP1–Y22, young panicles, where the number indicates the length of the panicle in centimeters. Expression levels are shown as relative number of copies per 1,000 copies of rice actin3. Data are given as mean ±s.e.m. (n= 4).

The expression profiles of OsSPL16in various organs of HJX74 were examined by quantitative RT-PCR analysis. OsSPL16 was preferentially expressed in developing panicles, and the highest levels of OsSPL16expression were found in panicles of 7 cm in length, whereas there was less transcript accumulation in the root, culm, leaf sheath, shoot meristem and young panicle(of <1 cm in length)[1]

You can also add sub-section(s) at will.

Labs working on this gene

The State Key Laboratory of Plant Cell and Chromosome Engineering, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, National Centre for Plant Gene Research, Beijing, China. The State Key Laboratory for Conservation and Utilization of Subtropical Agro-bioresources, South China Agricultural University, Guangzhou, China. The State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou, China. working Development of the SSSL population.Fine mapping of qGW8.Transgene constructs.Expression analysis.Histological analysis.Transactivation activity assay.Analysis of transgenic plants expressing OsSPL16.

References

  1. 1.0 1.1 1.2 1.3 Wang S, Wu K, Yuan Q, et al. Control of grain size, shape and quality by OsSPL16 in rice[J]. Nature genetics, 2012, 44(8): 950-954.

Structured Information