|
|
| (7 intermediate revisions by 3 users not shown) |
| Line 13: |
Line 13: |
| | Using a set of OsSERK1 primers (K-1; 5’AT(CT)AT(ATC)CATCG(AT)GATGTCAA3’ and K6-2; 5’CCATCTTGGGGCGTTCTGTG3’, where nucleotides in parentheses are a mixture). Actin (RAc-1; 5’AACTGGGATGATATGGAGAA3’, RAc-2; 5’CCTCCAATCCAGACACTGTA3’) was used as an internal control. The result showed that OsSERK1 was expressed in all organs and calli examined with different levels.Expression of OsSERK1 was relatively strong in a 1 DAP flower which contained a very early embryo, a leaf blade and a shoot apex<ref name="ref3" />. A callus on a regeneration medium with both cytokinin and auxin did not show significant change of the level of the OsSERK1expression in comparison to a callus on a callus-inducing medium(Fig.3 ).[[File:Expression of OsSERK1 and in various organs of rice.jpg|right|thumb|200px|''Fig.3 Expression of OsSERK1 and in various organs of rice(Poly(A)+RNAs isolated from the indicated organs were reversetranscribed and used as templates of the PCR. RT-PCR products were detected by Southern blot (OsSERK1) or ethidium bromide staining (actin). + and–indicate whether reverse transcriptase was add). (from reference <ref name="ref3" />).'']] | | Using a set of OsSERK1 primers (K-1; 5’AT(CT)AT(ATC)CATCG(AT)GATGTCAA3’ and K6-2; 5’CCATCTTGGGGCGTTCTGTG3’, where nucleotides in parentheses are a mixture). Actin (RAc-1; 5’AACTGGGATGATATGGAGAA3’, RAc-2; 5’CCTCCAATCCAGACACTGTA3’) was used as an internal control. The result showed that OsSERK1 was expressed in all organs and calli examined with different levels.Expression of OsSERK1 was relatively strong in a 1 DAP flower which contained a very early embryo, a leaf blade and a shoot apex<ref name="ref3" />. A callus on a regeneration medium with both cytokinin and auxin did not show significant change of the level of the OsSERK1expression in comparison to a callus on a callus-inducing medium(Fig.3 ).[[File:Expression of OsSERK1 and in various organs of rice.jpg|right|thumb|200px|''Fig.3 Expression of OsSERK1 and in various organs of rice(Poly(A)+RNAs isolated from the indicated organs were reversetranscribed and used as templates of the PCR. RT-PCR products were detected by Southern blot (OsSERK1) or ethidium bromide staining (actin). + and–indicate whether reverse transcriptase was add). (from reference <ref name="ref3" />).'']] |
| | 2.OsSERK genes were expressed in various organs but with some tissue specificity | | 2.OsSERK genes were expressed in various organs but with some tissue specificity |
| − | The OsSERK1 promoter showed reporter gene activities in some specific tissues in a germinating seed, leaf and root, but not in a developing embryo<ref name="ref3" />. This promoter activity suggests that OsSERK1 may have roles in non-embryonic tissues rather than in the embryo<ref name="ref3" />.OsSERK1 might also be involved in signaling of or response to phytohormones in these tissues(Fig.4 ).[[File:Tissue-specific GUS activities in the OsSERK1-GUS rice plants.jpg |left|thumb|200px|''Fig.4 Tissue-specific_GUS_activities_in_the_OsSERK1-GUS_rice_plants((A) 1-day imbibed embryo of plant #7. (B) Lamina joint of plant #7. (C) Growing lateral roots of plant #7. (D) Developing embryo (10 DAP) of plant #7. (E) 1-day imbibed embryo of plant #23. (F) Lamina joint of plant #23. (G) Growing lateral roots of plant).(from reference <ref name="ref3" />).'']] | + | The OsSERK1 promoter showed reporter gene activities in some specific tissues in a germinating seed, leaf and root, but not in a developing embryo<ref name="ref3" />. This promoter activity suggests that OsSERK1 may have roles in non-embryonic tissues rather than in the embryo<ref name="ref3" />.OsSERK1 might also be involved in signaling of or response to phytohormones in these tissues(Fig.4 ). |
| | 3.Rice SERKs are involved in BR signalling | | 3.Rice SERKs are involved in BR signalling |
| − | Overexpress the OsSERK1 rice gene in a weak BRI1 mutant,bri1-5.The transgenic Arabidopsis lines ectopically expressing OsSERK1 partially rescued the defective phenotypes of bri1-5(Fig.9).[[File:OsBAK1_rescue_partially_the_Arabidopsis_mutant_bri1-5.jpg |left|thumb|200px|''Fig.9 OsBAK1_rescue_partially_the_Arabidopsis_mutant_bri1-5.( (a) Phenotypes of bri1-5 and transgenic bri1-5,expressing OsSERK1 is shown, which were grown in soil for 3 weeks. (b) The phenotypesof longer petioles and larger leaves in transgenic Arabidopsis (a) are shown. ).(from reference <ref name="ref1" />).'']]Compared to bri1-5, transgenic plants expressing OsSERK1 showed larger statures, longer petioles and earlier flowering phenotypes<ref name="ref1" />.The expression of CPD has been widely used as a molecular marker to detect the effectiveness of the BR signalling pathway <ref name="ref5" />. BRI1 mutants usually show higher CPD expression levels than that of wild-type plants. Compared to bri1-5, the transgenic lines expressing OsSERKs showed significantly decreased expression of CPD (Fig.10).[[File:Real-time_PCR_analysed_theexpression_of_CPD_gene_in_transgenic_plants,_bri1-5_itself_and_wild-type_Ws-2.jpg |right|thumb|200px|''Fig.10 Real-time_PCR_analysed_theexpression_of_CPD_gene_in_transgenic_plants,_bri1-5_itself_and_wild-type_Ws-2.(from reference <ref name="ref1" />).'']]These results indicated that OsSERKs, like AtBAK1, can partially rescue bri1-5 mutant phenotypes.Functionally, OsSERK1 is the closest homolog of AtBAK1 in rice. Therefore, we named it as OsBAK1<ref name="ref1" />. | + | Overexpress the OsSERK1 rice gene in a weak BRI1 mutant,bri1-5.The transgenic Arabidopsis lines ectopically expressing OsSERK1 partially rescued the defective phenotypes of bri1-5(Fig.9).Compared to bri1-5, transgenic plants expressing OsSERK1 showed larger statures, longer petioles and earlier flowering phenotypes<ref name="ref1" />.The expression of CPD has been widely used as a molecular marker to detect the effectiveness of the BR signalling pathway <ref name="ref5" />. BRI1 mutants usually show higher CPD expression levels than that of wild-type plants. Compared to bri1-5, the transgenic lines expressing OsSERKs showed significantly decreased expression of CPD (Fig.10).These results indicated that OsSERKs, like AtBAK1, can partially rescue bri1-5 mutant phenotypes.Functionally, OsSERK1 is the closest homolog of AtBAK1 in rice. Therefore, we named it as OsBAK1<ref name="ref1" />. |
| | 4.The subcellular localization of OsBAK1 protein | | 4.The subcellular localization of OsBAK1 protein |
| − | The OsBAK1 protein in onion epidermis cells is located at plasma membrane<ref name="ref1" /> (Fig.5)[[File:The subcellular localization of OsBAK1 protein in onion epidermis cells.jpg|right|thumb|200px|''Fig.5 The_subcellular_localization_of_OsBAK1_protein_in_onion_epidermis_cellsThe upper panel shows the 35S::GFP signal alone, which is distributed on the plasma membrane, cytoplasm and nucleus; the middle panel displays the signal from 35S::OsBAK-GFP which is primarily located in the plasma membrane; the lower panel shows 35S::OsB). (from reference <ref name="ref1" />).'']] | + | The OsBAK1 protein in onion epidermis cells is located at plasma membrane<ref name="ref1" /> (Fig.5) |
| | 5.OsBAK1 interacts with OsBRI1 in vivo | | 5.OsBAK1 interacts with OsBRI1 in vivo |
| − | Full length OsBAK1,the extracellular domain (OsBAK1-ECD), the intracellular domain (OsBAK1-ICD), and a truncated intracellular domain (OsBAK1-ICDD)(Fig.11)[[File:The_structure_sketch_map_of_OsBAK1_protein.jpg|left|thumb|200px|''Fig.11 The_structure_sketch_map_of_OsBAK1_protein(OsBAK1 encoding 624 amino acid residues and including an extracellular domain (amino acid 1–299) and an intracellular domain (amino acid 300–624). The extracellular domain of OsBAK1 was named OsBAK1-ECD; the intracellular domain of OsBAK1 was named OsBAK1-ICD; a truncated intracellular domain of OsBAK1 (amino acid 348–624) was named OsBAK1- ICDD).<ref name="ref1" /> were fused to the N-terminal half of the yellow fluorescence protein (YN), respectively. The full length OsBRI1 protein was fused to the C-terminal half of the yellow fluorescence protein(YC).It shows tahtthe whole protein of OsBAK1, the extracellular domain, the intracellular domain and the truncated intracellular domain all appeared to interact with OsBRI1<ref name="ref1" />.(Fig.12)[[File:BiFC_assay_showed_the_interaction_of_OsBAK1_and_OsBRI1_in_vivo.jpg|left|thumb|200px|''Fig.12BiFC_assay_showed_the_interaction_of_OsBAK1_and_OsBRI1_in_vivo(The onion epidermis cells were cotransformated with OsBAK1-YN and YC, OsBRI1-YC and YN, OsBRI1-YC and OsBAK1-YN, OsBRI1-YC and OsBAK1-ECD-YN,OsBRI1-YC and OsBAK1-ICD-YN, and OsBRI1-YC and OsBAK1-ICDD-YN. Left line represents yellow fluorescence signal; right line represents the merge of YFP signal and bright field)).<ref name="ref1" /> | + | Full length OsBAK1,the extracellular domain (OsBAK1-ECD), the intracellular domain (OsBAK1-ICD), and a truncated intracellular domain (OsBAK1-ICDD)(Fig.11) |
| − | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Phylogenetic analysis and suppression of a weak Arabidopsis mutant bri1-5 indicated that OsBAK1 (Os08g0174700) is the closest relative of Arabidopsis BAK1(AtBAK1). Genetic, physiological, and biochemical analyses all suggest that the function of OsBAK1 is conserved with AtBAK1<ref name="ref3" />(Fig.6).[[File:A_phylogenetic_tree_of_the_SERK_family_protein_kinases_drawn_on_the_basis_of_predicted_entire_amino_acid_sequences.jpg|left|thumb|200px|''Fig.6 A_phylogenetic_tree_of_the_SERK_family_protein_kinases_drawn_on_the_basis_of_predicted_entire_amino_acid_sequences.(from reference <ref name="ref3"/>).'']] | + | Phylogenetic analysis and suppression of a weak Arabidopsis mutant bri1-5 indicated that OsBAK1 (Os08g0174700) is the closest relative of Arabidopsis BAK1(AtBAK1). Genetic, physiological, and biochemical analyses all suggest that the function of OsBAK1 is conserved with AtBAK1<ref name="ref3" />(Fig.6). |
| | Phylogenetic analysis of SERK proteins in Arabidopsis and rice. | | Phylogenetic analysis of SERK proteins in Arabidopsis and rice. |
| − | In order to search for AtBAK1 orthologs among the rice genes that were reported to be as OsSERKs or OsSERLs in the public database using the amino acid sequence of AtBAK1 as a query. It was difficult to determine which gene was an exact AtBAK1 ortholog, because many similar genes were identified<ref name="ref2" />. OsSERKs and OsBISERK1 cluster together, closer to each other than to any other AtSERKs based on amino acid sequence homology <ref name="ref4" />(Fig.7).[[File:Phylogenetic_analysis_of_SERK_proteins_in_Arabidopsis_and_rice.jpg|right|thumb|200px|''Fig.7 Phylogenetic_analysis_of_SERK_proteins_in_Arabidopsis_and_rice.(Amino acid sequences encoded by AtSERK1 (At1g71830),AtSERK2 (At1g34210), AtBAK1/AtSERK3 (At4g33430),AtSERK4/ BAK7/BKK1 (At2g13790), AtSERK5(At 2g13800) in Arabidopsis and OsSERK2(Os04g0457800),OsSERK3 (Os06g0225300), OsSERK4(Os02g0283800) in rice (Oryza) (from reference <ref name="ref4" />).'']] | + | In order to search for AtBAK1 orthologs among the rice genes that were reported to be as OsSERKs or OsSERLs in the public database using the amino acid sequence of AtBAK1 as a query. It was difficult to determine which gene was an exact AtBAK1 ortholog, because many similar genes were identified<ref name="ref2" />. OsSERKs and OsBISERK1 cluster together, closer to each other than to any other AtSERKs based on amino acid sequence homology <ref name="ref4" />(Fig.7). |
| − | | |
| | ===References=== | | ===References=== |
| | Please input cited references here. | | Please input cited references here. |
| Line 37: |
Line 35: |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os08g0174700|
| |
| − | Description = Similar to SERK1 (Fragment)|
| |
| − | Version = NM_001067643.1 GI:115475022 GeneID:4344785|
| |
| − | Length = 6295 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os08g0174700, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|
| |
| − | AP = Chromosome 8:4343174..4349468|
| |
| − | CDS = 4343458..4343542,4345257..4345389,4345463..4345534,4345871..4346014,4346735..4346806<br>,4346933..4347004,4347088..4347200,4347342..4347473,4347551..4347892<br>,4347975..4348369,4348640..4348954|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008401:4343174..4349468
| |
| − | source=RiceChromosome08
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008401:4343174..4349468
| |
| − | source=RiceChromosome08
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcggcgcatcggtgggcggtgtgggcggtgctgctgctgcggctgctcgtgccggcggcgcgggtgctcgccaacatggaaggtgatgcattgcatagcttgaggactaatttagttgatcctaataatgttctacaaagttgggacccaactctggtcaatccgtgcacttggtttcatgttacttgcaataacgacaacagtgttatcagagttgatcttgggaatgctgcactatcaggcactttggtcccacaacttgggcaactaaaaaacttgcaatacctggagctctacagtaataacataagcggaacgatacctagtgaacttggaaacctcacaaacttggtcagtttggatttgtacttgaacaacttcactggtccaataccagattcacttggaaacctattgaagctacgattcctgcgtcttaacaataacagcctttcgggttcaattcctaaatcactaactgctatcactgccctacaagttctagatctttcaaacaacaatttgtctggagaagttccatcaactggttccttttcattattcacccctatcagttttgccaacaacccttccttgtgtggtcctgggaccacaaaaccttgccctggtgctccccccttttccccacctcctccatataatcctccaactcctgtgcagtcaccagggagttcatctagtactggagcaattgctggtggagtggctgctggagcagccttgctatttgctattcctgctattggttttgcatggtatcggcgcaggaaaccccaagagcatttctttgatgtgcctgctgaggaggatccagaggtccatcttggccagcttaaaagattttcactacgagaactacaagttgcaacagataccttcagcaataaaaacattctcggaagaggtgggtttggcaaggtctataaaggaagattagcagatggttctttagtagctgttaagagactaaaggaggagagaacacctggtggggaactacagtttcaaacagaagttgagatgattagcatggctgtacatagaaatctgctgcgtttacgagggttctgtatgacacccacagaaaggttgcttgtgtatccatacatggctaatggaagcgttgcgtcacgtcttagagaacggccaccatcggaacctccacttgattggcgaacaagaagaaggattgcgttgggttccgccagggggctgtcctatttacatgatcattgtgacccaaagattatccatcgtgatgtcaaagctgcaaatattttattagatgaagactttgaagctgtagtaggggactttggtttggccaaactaatggattacaaggatacccatgtaacaactgcagttcgtggaacaattgggcatattgcaccagaatatctttcaacaggaaaatcatctgagaaaactgatgtatttggttatgggattatgcttttggagcttataacaggacaacgtgcctttgaccttgctcgtctagccaatgatgatgatgtcatgctactggactgggtaaaaggattactcaaggagaaaaggctggagatgttggttgatccagatttacagagcaactacattgatgttgaggtagaatcactaatccaggttgctcttctttgcacacaaggctcccccacagaacgccccaagatggcggaggttgtgaggatgcttgaaggtgatggccttgccgagagatgggaggagtggcagaagatagaagtagtacggcaggaggtagagcttggccctcatcggaactcagagtggattgtcgactcgacggacaaccttcatgcggttgagctatcagggccgaggtga</cdnaseq>|
| |
| − | AA = <aaseq>MAAHRWAVWAVLLLRLLVPAARVLANMEGDALHSLRTNLVDPNN VLQSWDPTLVNPCTWFHVTCNNDNSVIRVDLGNAALSGTLVPQLGQLKNLQYLELYSN NISGTIPSELGNLTNLVSLDLYLNNFTGPIPDSLGNLLKLRFLRLNNNSLSGSIPKSL TAITALQVLDLSNNNLSGEVPSTGSFSLFTPISFANNPSLCGPGTTKPCPGAPPFSPP PPYNPPTPVQSPGSSSSTGAIAGGVAAGAALLFAIPAIGFAWYRRRKPQEHFFDVPAE EDPEVHLGQLKRFSLRELQVATDTFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEE RTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASRLRERPP SEPPLDWRTRRRIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEDFEAVVGDFGLA KLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLAR LANDDDVMLLDWVKGLLKEKRLEMLVDPDLQSNYIDVEVESLIQVALLCTQGSPTERP KMAEVVRMLEGDGLAERWEEWQKIEVVRQEVELGPHRNSEWIVDSTDNLHAVELSGPR </aaseq>|
| |
| − | DNA = <dnaseqindica>285..369#2084..2216#2290..2361#2698..2841#3562..3633#3760..3831#3915..4027#4169..4300#4378..4719#4802..5196#5467..5781#atcgacggtataaagcgaggcgacgaactgactcgactcaactcaaccccccccaaaaaaaagaagaaaaaaaagaaaaagaaaaaaaagtcgtcgaaaagcgagagaaggggatcgattcgaagagagaggaggtaaagcggcggcgggagaatcttcgccggatcggcggcggtggcggaggaggaggaggaggaggaggaagagggtggtgctgatttggtgtggaggcggggaaatgcgtgatgtgtgagatctagggcgtggggaggcggatcgcggcaatggcggcgcatcggtgggcggtgtgggcggtgctgctgctgcggctgctcgtgccggcggcgcgggtgctcgccaacatggaaggtgggtggggggggaggtttgcgtttgagttgagcttttgcttgggttttggtcgatctggggtgtgttcttgctgggttggagtggattggtgtcgggagcttggggggtggctgcttgcttggcttggtttgagcagttagtacaagttgccgcggctgctggtttttgctgtgtgtgtaagttgctacgagacgtcgcttgattttggtttgatgcgtggccgctttgtacggatcctaccttttttactctccctcgcggaagaatcggagcattttctcgaatttttctccggtcgaatttggacttctctgcgttccaaattcactccgaattcccctagcctgtgaattgcttcaaaaatctgcgcaaagtcgggagctaaatttgcgctttcaaaatgtgaaacccttgtcggaaaaaagttgccatcgcgtttgatttaatttaatttaattttccatgcatttggatcatgtgttctattgaatgaagatttgaactgtgctgcgccgatgctgcacgtttcggagatttcccctttctatcgggtttctgcgtgcgcttgagagagctactgttgcattaaatcgcgttgctacacgttgcttgctagttgttcatggactaatctgctagagctgtgttaatcgattctttcccgtggttgttaggtcttgattaggacgtctaatgacgtggttttgctatttcgggccattgttagattcgagctgtcggtgcctaagttcgtgacataattgggttaccttttcgcgcgcgcgtgcgggttggtggctaggtgatttttcaagccggactttgtgtctaatcatggtacgaaatgggatggatcgtttcgattgcggattttctcgagcatggcttgtttagtcttgagatcccagttgcttaggcctgcctgggattgattaggacgttgatgcgcgtttgacgacgctagactgctaattttgggggtgggattggttgtatgtgtgtagttctagttggggattcggcaaattgtagtgggggcctgtgagctgtgggtcaaattgtattttccaggacaattggtagttgatgtgtgatcttgaagcttcaagcacctgaagcctgatggtgattgcttgtatttgaaaactttggtagtagtaggatataaagaggccaagttggtgttgtaattttcattttagttcgaccctttgatgctgatctcttacttaggtacttactttggagtgattcataagaaaatttaaaagcttattcacgacttacattctcataattgagatgttctcataattgatgatattttgagtttggctcactggttttaagtctagcgtctaagagttatctttcatgtacttatttgcccctttgtcatatactagagtaacaatttaactttttttaaaaacaaatcatactagctatggctgatgaaatggaatttttttgacatacaagtcagatagaattgtgccagatgcaatacaaacaccacatgaatcatgcatgctagttgaccttttggtttcgctccttttctgcatgatgatttggagtgttttcctttggacaaattctattttcaatctacacaacaattattagctactatttatgcacaatcctcattgattgtttggttaaattttattcacctgttgttgatacatgattctattattggcaggtgatgcattgcatagcttgaggactaatttagttgatcctaataatgttctacaaagttgggacccaactctggtcaatccgtgcacttggtttcatgttacttgcaataacgacaacagtgttatcagagtgtacgtgctaccttttgtctactatgcaatccacgcctcatacatttttattgaaattatctccatttttcagtgatcttgggaatgctgcactatcaggcactttggtcccacaacttgggcaactaaaaaacttgcaatacctgtaagttctcttcctgttgttaagtgttgtgcacatcattaaatgccattcctgctgcacatggtgcaatgttttgtcattgttctgatctttgaatttaggttaataccttgtaatgtgatatacgaattcatataataaatgttccattttgtaaataaatgcctattacctttcttatgtgagtatgtgatgaatgtctcacctatatcatcagaatatctacagtcacgtggagaaatattcctagctagtgtgttgtgctcagatcaactcaagccaatcactgagtattgtagagtattaatgttcattgttttcttctttatgatgcagggagctctacagtaataacataagcggaacgatacctagtgaacttggaaacctcacaaacttggtcagtttggatttgtacttgaacaacttcactggtccaataccagattcacttggaaacctattgaagctacgattcctgtatgcttctactttactagctaaccgcttctacatatttacgtttagtagagatatacatggtcagccatctcatatttttaggacttggaaactatacttaaatacatatgttttagctggtgagtatttttgagctctcaacctaaggatcttgaattttcagaacacatattctcttagcatagtgcattggaatattggatagagatgaaatgaatctgtggtagtatcggttcatggcaatataaagcctatcgttgagaatcatgctgatgtagccaaccatatagctaaattggttttgtcgaccatttaacctgatatcaatggacagttggacacgcaatgcttacatattttggataacagcacttaacatggtaatgccattgttttaccaacatgcacttataagtgggaaaacattgccatgtgtactacaacaaaatgatttggttcgatttgttttcctggtctgaccttttcattcaacttggttgtgcattagtacattgcaattatatttccagactgctgtttatgagatgatggatagcttttgctactttctcactccttttctgatgttttagggcatctcctatgcctcttgattttcgaagtagttttctagagtctctgcattatatttattctctgtcattttctgtcaatgttactaatttggtgacttattttgtatttctgcgaggataggcgtcttaacaataacagcctttcgggttcaattcctaaatcactaactgctatcactgccctacaagttctgtaagttatcccccccccctttattatacacttgtttaatcctttcttttcagtgtagtctttgttttttgttctgtggtttaattagtaaataacccatggtcaatgttttctatttaattaaagagatctttcaaacaacaatttgtctggagaagttccatcaactggttccttttcattattcacccctatcaggtaaaactagatttaataatgattgcagttcactgctcttttccaatacactgctgctatttacacttgcctgtcttttgcagttttgccaacaacccttccttgtgtggtcctgggaccacaaaaccttgccctggtgctccccccttttccccacctcctccatataatcctccaactcctgtgcagtcaccaggtgagatctgttcatattcacagctgtgcaacagccaacactatgatttttttttgttgcactgacgcgtggtacttatgctggtatggactatggaacatattgttgttgttctgacaataataacctcatgttctatagggagttcatctagtactggagcaattgctggtggagtggctgctggagcagccttgctatttgctattcctgctattggttttgcatggtatcggcgcaggaaaccccaagagcatttctttgatgtgcctggtaagcgtccaatagaacaagcgaacttggagaataatattgagccaactttgattgagattcattatttgttacagctgaggaggatccagaggtccatcttggccagcttaaaagattttcactacgagaactacaagttgcaacagataccttcagcaataaaaacattctcggaagaggtgggtttggcaaggtctataaaggaagattagcagatggttctttagtagctgttaagagactaaaggaggagagaacacctggtggggaactacagtttcaaacagaagttgagatgattagcatggctgtacatagaaatctgctgcgtttacgagggttctgtatgacacccacagaaaggttgcttgtgtatccatacatggctaatggaagcgttgcgtcacgtcttagaggtacgttgccttttttttttccaatctgacatccctgtatctttcagataattggagggttgatttgggttttatattatagaacggccaccatcggaacctccacttgattggcgaacaagaagaaggattgcgttgggttccgccagggggctgtcctatttacatgatcattgtgacccaaagattatccatcgtgatgtcaaagctgcaaatattttattagatgaagactttgaagctgtagtaggggactttggtttggccaaactaatggattacaaggatacccatgtaacaactgcagttcgtggaacaattgggcatattgcaccagaatatctttcaacaggaaaatcatctgagaaaactgatgtatttggttatgggattatgcttttggagcttataacaggacaacgtgcctttgaccttgctcgtctagccaatgatgatgatgtcatgctactggactgggtaattgactagcacaatcttcaattcaaattgcagtccatattcatgcccttttgtggcttgatgttgtgttgggagttagataaaattacttttatgtatgtccaaaatcgtatcatataaaaaatagtagttacagtaaggtcttaaaagtagtcctttttttaatcattatggcattagctaagctaagcataggattgaacatcatcgtctgagaaatacactgttatatggtaagccaatattcatgtgctgtgctttgtgcaggtaaaaggattactcaaggagaaaaggctggagatgttggttgatccagatttacagagcaactacattgatgttgaggtagaatcactaatccaggttgctcttctttgcacacaaggctcccccacagaacgccccaagatggcggaggttgtgaggatgcttgaaggtgatggccttgccgagagatgggaggagtggcagaagatagaagtagtacggcaggaggtagagcttggccctcatcggaactcagagtggattgtcgactcgacggacaaccttcatgcggttgagctatcagggccgaggtgatgacagcgcactggtagtttgctgctaattcttgtccgtcggaagagtgatttttatcagccatcctagtcgaatcgccatttgttcataccaaccaattggcccaatgtagccagctacaactatgttttgatgtatattgcttgatttgctccttgatgtgccgccttggatatcggtgacccgaaaacagcaggagcccaaggaactattgtcctgaagcttgcaagttgcaacaagatcccagtatgttaaagctcacaaggtagcagctaggagtgaggttgctgcggctgtttgctggacctgtgaaaattgtactgactggtgacatctaactattttgtaccaaatgtaaggaaaaaccatggtattattactttggcctcctctgggaaaggttcagaactttcagatgatgcagttggcctcactggtatactctatttggacatttgattatgatgtgtttactgtaaatgatacccagttctgaatcaaatgtaccttctgc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001067643.1 RefSeq:Os08g0174700]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Please input one-sentence summary here.
Annotated Information
Function
The gene Os08g0174700 encode a somatic embryogenesis(SERK-family)receptor-like protein kinase 1(OsSERK1).Functionally, OsSERK1 is the closest homolog of AtBAK1 in
rice. Therefore, we named it as OsBAK1( BRI1-Associated receptor Kinase 1)[1]. The expression of OsBAK1changed important agricultural traits of rice such as plant height, leaf erectness, grain morphologic features, and disease resistance responses. A new rice variety with erect-leaf and normal reproduction can be generated simply by suppressing the expression level of OsBAK1[1].
Reduceing levels of OsBAK1 and decreasing sensitivity to BL will lead to semidwarfism in overall growth and result in abnormal growth patterns(Fig.1)
Fig.1The_unnormal_growth_condition_of_OsBAK1.(The outer appearance of OsBAK1RNAi line leaves (right) showing constitutive sickness compared with those of control plants (left) grown for two weeks. (from reference [2]). , especially in leaf development(Fig.8)
Fig.8 Defective_leaf_development_of__OsBAK1_RNAi_plants.(A) Surface of leaves of an OsBAK1RNAi plants (right) and control plant (left) grown for four weeks.Pictures in the lower panel show higher magnification of the boxed region.White bars indicate 300 µm. (B) Internal structures of leaves of an OsBAK1RNAi #5 plant (right) and a wild-type plant (left) grown for five weeks. Leaves containing veins were transversely sectioned by hand and observed under a compound microscope. Bulliform cells shown in wild-type plants are marked with arrow heads. Bar indicates 500 µm.(from reference [2]). . OsBAK1RNAi transgenic rice plants are defective in the development of bulliform cells in the leaf epidermal layer and increase expression level of pathogenesis related gene and enhance susceptibility to a rice blast-causing fungal pathogen, Magnaporthe oryzae (Fig.2)
Fig.2 Higher susceptibility to biotic stress of leaves of OsBAK1RNAi plants.(Extent of OsBAK1RNAi line (right) infection with Magnaporthe oryzae compared to wild-type plant (left) grown for 7 weeks. Enlarged leaf features of them are shown in the lower panel.)(from reference [2]). . OsBAK1, play versatile roles in rice growth and development
[2].
Expression
1.Expression of OsSERK1 and in various organs of rice
Using a set of OsSERK1 primers (K-1; 5’AT(CT)AT(ATC)CATCG(AT)GATGTCAA3’ and K6-2; 5’CCATCTTGGGGCGTTCTGTG3’, where nucleotides in parentheses are a mixture). Actin (RAc-1; 5’AACTGGGATGATATGGAGAA3’, RAc-2; 5’CCTCCAATCCAGACACTGTA3’) was used as an internal control. The result showed that OsSERK1 was expressed in all organs and calli examined with different levels.Expression of OsSERK1 was relatively strong in a 1 DAP flower which contained a very early embryo, a leaf blade and a shoot apex
[3]. A callus on a regeneration medium with both cytokinin and auxin did not show significant change of the level of the OsSERK1expression in comparison to a callus on a callus-inducing medium(Fig.3 ).
Fig.3 Expression of OsSERK1 and in various organs of rice(Poly(A)+RNAs isolated from the indicated organs were reversetranscribed and used as templates of the PCR. RT-PCR products were detected by Southern blot (OsSERK1) or ethidium bromide staining (actin). + and–indicate whether reverse transcriptase was add). (from reference [3]).
2.OsSERK genes were expressed in various organs but with some tissue specificity
The OsSERK1 promoter showed reporter gene activities in some specific tissues in a germinating seed, leaf and root, but not in a developing embryo[3]. This promoter activity suggests that OsSERK1 may have roles in non-embryonic tissues rather than in the embryo[3].OsSERK1 might also be involved in signaling of or response to phytohormones in these tissues(Fig.4 ).
3.Rice SERKs are involved in BR signalling
Overexpress the OsSERK1 rice gene in a weak BRI1 mutant,bri1-5.The transgenic Arabidopsis lines ectopically expressing OsSERK1 partially rescued the defective phenotypes of bri1-5(Fig.9).Compared to bri1-5, transgenic plants expressing OsSERK1 showed larger statures, longer petioles and earlier flowering phenotypes[1].The expression of CPD has been widely used as a molecular marker to detect the effectiveness of the BR signalling pathway [4]. BRI1 mutants usually show higher CPD expression levels than that of wild-type plants. Compared to bri1-5, the transgenic lines expressing OsSERKs showed significantly decreased expression of CPD (Fig.10).These results indicated that OsSERKs, like AtBAK1, can partially rescue bri1-5 mutant phenotypes.Functionally, OsSERK1 is the closest homolog of AtBAK1 in rice. Therefore, we named it as OsBAK1[1].
4.The subcellular localization of OsBAK1 protein
The OsBAK1 protein in onion epidermis cells is located at plasma membrane[1] (Fig.5)
5.OsBAK1 interacts with OsBRI1 in vivo
Full length OsBAK1,the extracellular domain (OsBAK1-ECD), the intracellular domain (OsBAK1-ICD), and a truncated intracellular domain (OsBAK1-ICDD)(Fig.11)
Evolution
Phylogenetic analysis and suppression of a weak Arabidopsis mutant bri1-5 indicated that OsBAK1 (Os08g0174700) is the closest relative of Arabidopsis BAK1(AtBAK1). Genetic, physiological, and biochemical analyses all suggest that the function of OsBAK1 is conserved with AtBAK1[3](Fig.6).
Phylogenetic analysis of SERK proteins in Arabidopsis and rice.
In order to search for AtBAK1 orthologs among the rice genes that were reported to be as OsSERKs or OsSERLs in the public database using the amino acid sequence of AtBAK1 as a query. It was difficult to determine which gene was an exact AtBAK1 ortholog, because many similar genes were identified[2]. OsSERKs and OsBISERK1 cluster together, closer to each other than to any other AtSERKs based on amino acid sequence homology [5](Fig.7).
References
Please input cited references here.
- ↑ 1.0 1.1 1.2 1.3 1.4 Dan Li; Lei Wang; Min Wang; Yun-Yuan Xu; Wei Luo; Ya-Ju Liu; Zhi-Hong Xu; Jia Li; Kang Chong Engineering OsBAK1 gene as a molecular tool to improve rice architecture for high yield Plant Biotechnology Journal, 2009, 7(8): 791-806.
- ↑ 2.0 2.1 2.2 2.3 2.4 Hye Sun Park;Hee Young Ryu;Beg Hab Kim;Sun Young Kim;In Sun Yoon;Kyoung Hee Nam A subset of OsSERK genes, including OsBAK1, affects normal growth and leaf development of rice Molecules and Cells, 2011, 32(6): 561-569.
- ↑ 3.0 3.1 3.2 3.3 3.4 Yukihiro Ito; Kazuhiko Takaya; Nori Kurata Expression of SERK family receptor-like protein kinase genes in rice Biochimica et Biophysica Acta, 2005, 1730(3): 253-258.
- ↑ Albrecht, C., Russinova, E., Kemmerling, B., Kwaaitaal, M. and de Vries, S.C. (2008) Arabidopsis somatic embryogenesis receptor kinase proteins serve brassinosteroid dependent and independent signaling pathways. Plant Physiology, 148, 611–619.
- ↑ Guindon, S., and Gascuel, O.A simple, fast, and accurate algorithm to estimate large phylogenies by maximum likelihood.Syst. Biol. 2003,52, 696-704.
Structured Information