Difference between revisions of "Os04g0301500"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
 
(4 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''Os04g0301500''' was reported as '''''OsbHLH006''''' in 2006 <ref name="ref1" /> by researchers from the China. It is a member of bHLH transcription factor gene family.
  
 
==Annotated Information==
 
==Annotated Information==
The RERJ1 cDNA is 1353 bp in length, with an open reading frame (ORF) encoding a putative polypeptide of 310 amino acid residues. The nucleotide sequence data
+
===Gene Symbol===
for the RERJ1 cDNA reported here will appear in the GSDB, DDJB, EMBL, and NCBI nucleotide sequence databases under Accession No. AB040744.
+
*'''''Os04g0301500''''' '''''<=>''''' '''''OsbHLH006'''''
The putative amino acid sequence of RERJ1 contains a bHLH motif characteristic of a superfamily of transcriptional regulators The entire amino acid sequence
 
of RERJ1 shares less than 20% identity with bHLH proteins functionally characterized so far.
 
  
== Introduction ==
 
Jasmonic acid (JA) is a plant hormone that regulates various developmental processes in plants and also acts as a signal molecule in plant defense against herbivores and pathogens. Treatment of suspension-cultured rice cells with a chitin elicitor (N-acetylchitoheptaose) induces the production of phytoalexins. JA is a key signal transducer between the recognition of N-acetylchitoheptaose and the production of the phytoalexin momilactone A in rice cells. Screened for cDNAs
 
for early JA-responsive genes using a cDNA library constructed from suspension-cultured rice cells treated with JA for 1/2 h. This resulted in the isolation of a cDNA for RERJ1, which is also induced by treatment with JA. It was suggested that RERJ1 encodes a novel transcriptional regulator with a basic helix–loop–helix
 
(bHLH) motif. Basic HLH proteins, which have been identified in all eukaryotes examined to date, form either homo- or hetero-dimers. These proteins constitute a
 
superfamily of transcription factors that has been extensively characterized in non-plant eukaryotes, in particular in mammalian systems, in which they have important roles in neurogenesis, myogenesis, cell proliferation and differentiation, cell lineage establishment, sex determination,and other essential processes .
 
 
===Function===
 
===Function===
Please input function information here.
+
* The basic/helix-loop-helix (bHLH) transcription factors and their homologs form a large family in plant and animal genomes.
RERJ1, a JA-inducible transcription factor in rice, is up-regulated by exposure to wounding and drought stress.RERJ1 has self-activating ability. It is a upregulated genes in plants under the drought stress and the mechanical damage.And after mechanical damage, its expression is affected by a JA-dependent manner. RERJ1 only  induced in place where mechanical damaged, but the drought make it expressed throughout the leaf area. Therefore, RERJ1 as a transcriptional activator can regulate gene expression induced by stress, and this stress related with JA accumulation areas.RERJ1 plays a role as a transcriptional activator for regulating stress-inducible gene expression, with a strong correlation to JA accumulation in the stressed region.
+
* rice bHLH proteins can potentially participate in a variety of combinatorial interactions, endowing them with the capacity to regulate a multitude of transcriptional programs.
The plant bHLH proteins that have been characterized to date function in transcriptional regulation associated with several physiological phenomena, including anthocyanin pigmentation , DELILA in snapdragon. The biological functions of most plant bHLH proteins remain unclear.The molecular cloning and characterization
+
* bHLHs represent key regulatory components in transcriptional networks controlling a number of biological processes.
of the JA-responsive rice gene RERJ1, which encodes a bHLH protein.
+
* Plant bHLHs have been reported to function in light signaling, hormone signaling, wound and drought stress responses, symbiotic ammonium transport, shoot branching, root, fruit and flower development, et al. <ref name="ref1" /> <ref name="ref2" /> <ref name="ref3" />
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* Similar expression patterns suggest functional conservation between some rice bHLH genes and their close Arabidopsis homologs.
The expression of RERJ1 after wounding is regulated in a JA-dependent manner in rice. RERJ1 expression was induced only at the region of injury after wounding, whereas expression was induced in the entire leaf after drought. According to JA measurements of stressed leaves, high accumulation of endogenous JA was only detected around the wound site in a rice leaves, whereas the drought treatment led to uniform accumulation of JA in the entire leaf, suggesting that RERJ1 will be a useful marker gene for studies on localization of JA in rice.
+
 
It was suggested that RERJ1 encodes a novel transcriptional regulator with a basic helix–loop–helix(bHLH) motif.
 
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* The studies of researchers indicate that the ancient bHLH gene family has likely expanded considerably during flowering plant evolution to include many relatively young members, allowing both the conservation and divergence of gene function.
AN1 and JAF13 in petunia
 
GMYC1 in gerbera
 
anthocyanin pigmentation/trichome differentiation in Arabidopsis, phytochrome signaling(PIF3 and HFR1), globulin expression (PG1in Phaseolus vulgaris) , and symbiotic ammonium transport.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Shanghai Jiao Tong University-Shanghai Institutes for Biological Sciences-Pennsylvania State University Joint Center for Life Sciences, Key Laboratory of Microbial Metabolism, Ministry of Education, School of Life Science and Biotechnology, Shanghai Jiao Tong University, Shanghai, People’s Republic of China, 200240
 Plant materials
+
* School of Life Science, Shanghai University, Shanghai, People’s Republic of China, 200444
 Microscopic observation
+
* School of Life Science, Xiamen University, Xiamen, People’s Republic of China, 361005
 Scanning electron microscopy observation
+
* Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai, People’s Republic of China, 200032
 Positional cloning
+
* Department of Biology and the Huck Institutes of the Life Sciences, Pennsylvania State University, University Park, Pennsylvania 16802
 Promoter activity analysis
 
 Subcellular localization
 
 Real-time quantitative PCR
 
 mRNA in situ hybridization
 
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
Koji Miyamoto;Takafumi Shimizu;Susumu Mochizuki;Yoko Nishizawa;Eiichi Minami;Hideaki Nojiri;Hisakazu Yamane;Kazunori Okada
+
* <ref name="ref1">
  Stress-induced expression of the transcription factor RERJ1 is tightly regulated in response to jasmonic acid accumulation in rice
+
Li X, Duan X, Jiang H, Sun Y, Tang Y, Yuan Z, Guo J, Liang W, Chen L, Yin J,
  Protoplasma, 2013, 250(1): 241-249
+
Ma H, Wang J, Zhang D. Genome-wide analysis of basic/helix-loop-helix
 +
transcription factor family in rice and Arabidopsis. Plant Physiol. 2006
 +
Aug;141(4):1167-84. PubMed PMID: 16896230; PubMed Central PMCID: PMC1533929.
 +
</ref>
 +
* <ref name="ref2">
 +
Carretero-Paulet L, Galstyan A, Roig-Villanova I, Martínez-García JF,
 +
Bilbao-Castro JR, Robertson DL. Genome-wide classification and evolutionary
 +
analysis of the bHLH family of transcription factors in Arabidopsis, poplar,
 +
rice, moss, and algae. Plant Physiol. 2010 Jul;153(3):1398-412. doi:
 +
10.1104/pp.110.153593. PubMed PMID: 20472752; PubMed Central PMCID: PMC2899937.
 +
</ref>
 +
* <ref name="ref3">
 +
Feller A, Machemer K, Braun EL, Grotewold E. Evolutionary and comparative
 +
analysis of MYB and bHLH plant transcription factors. Plant J. 2011
 +
Apr;66(1):94-116. doi: 10.1111/j.1365-313X.2010.04459.x. Review. PubMed PMID:
 +
21443626.
 +
 
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os04g0301500|
 
Description = Basic helix-loop-helix dimerisation region bHLH domain containing protein|
 
Version = NM_001058941.1 GI:115457611 GeneID:4335417|
 
Length = 2402 bp|
 
Definition = Oryza sativa Japonica Group Os04g0301500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
 
AP = Chromosome 4:13515243..13517644|
 
CDS = 13515513..13515611,13516595..13517065,13517150..13517429,13517497..13517579|
 
GCID = <gbrowseImage1>
 
name=NC_008397:13515243..13517644
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008397:13515243..13517644
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggacgccgagatggccatgggcgagagcttcgcctactactgggagacgcagcgctaccttgagtccgaggagctcgacagcatgtacctgccgacgcaggatgactccaactacgagtcgagctcgccggacgggtcgcactcgtcgtcggcgccggcgccggcggccgtgggcggggacgcagccgccgcggtggcgggtagcggtggcgggatgacgacgatgatgatgggcggcggcggcggcggtggcgacgacgccggtggcgcgaacaagaacatcctcatggagcgcgaccgccgccgcaagctcaacgagaagctctacgcgctccgcagtgtcgtgcccaacatcaccaagatggacaaggcgtcgatcatcaaggacgcgatcgagtacatccagcgcctgcaggcggaggagcagcagatgctccgggaggtcgccgcgctcgagtccgccgccgcggcgagcgccgccccggccgcggcgaacccgttcgccggcctcggcgccgacgaggaacacgagtacggccaccaccacccctcgtcgtcgtcggagcggacgaagaaggtgaagcgggcgctgtccgtgtcgtccatcagcgacgccctgctcgccgcggcggcgccggcgccgccggtggagatccaggagctgcgcgtgtcggaggtgggcgacagggtgctggtggtgagcgtgacgtgcagcaagcgccgcgacgccatggcccgggtgtgccgcgccctcgaggagctccgcctccgcgtcatcaccgccaacatcacctccgtcgccggctgcctcatgcacaccctcttcgtcgaggtagatcacatggatagtgtccaaatgaagcagatggtggaggctgctctctcccagcttgtggcgaccggcagtccgttgagctccatgagctattag</cdnaseq>|
 
AA = <aaseq>MDAEMAMGESFAYYWETQRYLESEELDSMYLPTQDDSNYESSSP                    DGSHSSSAPAPAAVGGDAAAAVAGSGGGMTTMMMGGGGGGGDDAGGANKNILMERDRR                    RKLNEKLYALRSVVPNITKMDKASIIKDAIEYIQRLQAEEQQMLREVAALESAAAASA                    APAAANPFAGLGADEEHEYGHHHPSSSSERTKKVKRALSVSSISDALLAAAAPAPPVE                    IQELRVSEVGDRVLVVSVTCSKRRDAMARVCRALEELRLRVITANITSVAGCLMHTLF                    VEVDHMDSVQMKQMVEAALSQLVATGSPLSSMSY</aaseq>|
 
DNA = <dnaseqindica>2034..2132#580..1050#216..495#66..148#gtcggagagagacacaagccaacctcgaactcgaagcagagcaaacgcgaagcagagcaagcgccatggacgccgagatggccatgggcgagagcttcgcctactactgggagacgcagcgctaccttgagtccgaggagctcgacaggtgcgcctccgcctcgccgccgccgccgatccgccattgttgttgctgacatggtgtttggttgcagcatgtacctgccgacgcaggatgactccaactacgagtcgagctcgccggacgggtcgcactcgtcgtcggcgccggcgccggcggccgtgggcggggacgcagccgccgcggtggcgggtagcggtggcgggatgacgacgatgatgatgggcggcggcggcggcggtggcgacgacgccggtggcgcgaacaagaacatcctcatggagcgcgaccgccgccgcaagctcaacgagaagctctacgcgctccgcagtgtcgtgcccaacatcaccaaggtaagggagagaggagtagaggtgttcgtccatggcggcgacggcgacattgctgactgactgctcgtcggtggttgggcgcagatggacaaggcgtcgatcatcaaggacgcgatcgagtacatccagcgcctgcaggcggaggagcagcagatgctccgggaggtcgccgcgctcgagtccgccgccgcggcgagcgccgccccggccgcggcgaacccgttcgccggcctcggcgccgacgaggaacacgagtacggccaccaccacccctcgtcgtcgtcggagcggacgaagaaggtgaagcgggcgctgtccgtgtcgtccatcagcgacgccctgctcgccgcggcggcgccggcgccgccggtggagatccaggagctgcgcgtgtcggaggtgggcgacagggtgctggtggtgagcgtgacgtgcagcaagcgccgcgacgccatggcccgggtgtgccgcgccctcgaggagctccgcctccgcgtcatcaccgccaacatcacctccgtcgccggctgcctcatgcacaccctcttcgtcgaggtataatacaatctccatctccattgctgacgtcacgcacgatcactgagctcctcttcctttccttaggtttgaccttccaagtttgactttgaccgttcacacgcagtactacattttacttccatttttaggtagaaaaataacgttgcgatcacacgctgctccctttgcggcgtcagtatgttaggccaatcaaatcctcaccaatcctaaagcaaccgtcccgaatctcaaagcatcagaaaatccccttctccccgctttacgaatccacctgattcttcttcttctgttcttcgattgcaaaaagcgattgaaaaccacatgggattaatcgggtgcgcacgagggagaaatcgaacaattcgatggatggatggatcgcgcacgtgcttcagataataattaatgaattaattttttgggggacaaacgggagcactacatctacatgggcgtcacatcacgtgcgtgttttggttgggggaagccatggaaaacgattggcacgtgttcgattgcacgggagatgatttttttcccctcgtttttttatttgttgtgacgttaaattccacacttttctttaagctgatttgattacagatgtgaagacaacagtttttgggggatgttctgtgttttgtcctcttctagaaattaggtgtttgatacacattattgaggccgagttagttttttttttttggggattgaggctgagttagtttgttgacttccacgtgcatgcacgtttcttgaactgttaaatttttaaaagaaattatacaaaaattgttttaaataaatcataacaatatattttttaagatttttaaaatatatttaattaatcatgtgttaatccattactctattttacgtgcggagggaaggggttcgcaacctcttcaaaagaacaaaaccttagcattgttaattttggggttttggctgaataaagttgtttcaaatttcaggtagatcacatggatagtgtccaaatgaagcagatggtggaggctgctctctcccagcttgtggcgaccggcagtccgttgagctccatgagctattagttatgagctggatagatatatggagtcatgcgttttggccacctactttacctagtctcattcgcaataaagcgcatttttatgtatgcttggtgatgttgttgttgtcatttttgcgacaccccactacgtgatggaggtggttgttttcttgcgaggcaacgatttagtggctggatgatagatttaagtattttggaaatcttgagtacgctgacttgtttatgtagctattaatattgatgaataataaggtggtccagcttaatg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001058941.1 RefSeq:Os04g0301500]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 00:55, 22 March 2017

The rice Os04g0301500 was reported as OsbHLH006 in 2006 [1] by researchers from the China. It is a member of bHLH transcription factor gene family.

Annotated Information

Gene Symbol

  • Os04g0301500 <=> OsbHLH006

Function

  • The basic/helix-loop-helix (bHLH) transcription factors and their homologs form a large family in plant and animal genomes.
  • rice bHLH proteins can potentially participate in a variety of combinatorial interactions, endowing them with the capacity to regulate a multitude of transcriptional programs.
  • bHLHs represent key regulatory components in transcriptional networks controlling a number of biological processes.
  • Plant bHLHs have been reported to function in light signaling, hormone signaling, wound and drought stress responses, symbiotic ammonium transport, shoot branching, root, fruit and flower development, et al. [1] [2] [3]

Expression

  • Similar expression patterns suggest functional conservation between some rice bHLH genes and their close Arabidopsis homologs.

Evolution

  • The studies of researchers indicate that the ancient bHLH gene family has likely expanded considerably during flowering plant evolution to include many relatively young members, allowing both the conservation and divergence of gene function.

You can also add sub-section(s) at will.

Labs working on this gene

  • Shanghai Jiao Tong University-Shanghai Institutes for Biological Sciences-Pennsylvania State University Joint Center for Life Sciences, Key Laboratory of Microbial Metabolism, Ministry of Education, School of Life Science and Biotechnology, Shanghai Jiao Tong University, Shanghai, People’s Republic of China, 200240
  • School of Life Science, Shanghai University, Shanghai, People’s Republic of China, 200444
  • School of Life Science, Xiamen University, Xiamen, People’s Republic of China, 361005
  • Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai, People’s Republic of China, 200032
  • Department of Biology and the Huck Institutes of the Life Sciences, Pennsylvania State University, University Park, Pennsylvania 16802

References

  1. 1.0 1.1 Li X, Duan X, Jiang H, Sun Y, Tang Y, Yuan Z, Guo J, Liang W, Chen L, Yin J, Ma H, Wang J, Zhang D. Genome-wide analysis of basic/helix-loop-helix transcription factor family in rice and Arabidopsis. Plant Physiol. 2006 Aug;141(4):1167-84. PubMed PMID: 16896230; PubMed Central PMCID: PMC1533929.
  2. Carretero-Paulet L, Galstyan A, Roig-Villanova I, Martínez-García JF, Bilbao-Castro JR, Robertson DL. Genome-wide classification and evolutionary analysis of the bHLH family of transcription factors in Arabidopsis, poplar, rice, moss, and algae. Plant Physiol. 2010 Jul;153(3):1398-412. doi: 10.1104/pp.110.153593. PubMed PMID: 20472752; PubMed Central PMCID: PMC2899937.
  3. Feller A, Machemer K, Braun EL, Grotewold E. Evolutionary and comparative analysis of MYB and bHLH plant transcription factors. Plant J. 2011 Apr;66(1):94-116. doi: 10.1111/j.1365-313X.2010.04459.x. Review. PubMed PMID: 21443626.

Structured Information