|
|
| (19 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''Os01g0952800''' was reported as '''''OsbHLH056''''' in 2006 <ref name="ref1" /> by researchers from the China. It is a member of bHLH transcription factor gene family. |
| | | | |
| | + | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os01g0952800''''' '''''<=>''''' '''''OsbHLH056''''' |
| | | | |
| − | ==Annotated Information==
| |
| | ===Function=== | | ===Function=== |
| − |
| + | * The basic/helix-loop-helix (bHLH) transcription factors and their homologs form a large family in plant and animal genomes. |
| − | OsIRO2, an Fe-deficiency-inducible basic helix-loop-helix (bHLH) transcription factor, is responsible for regulation of the genes involved in Fe homeostasis in rice. This gene has the activity of transcription, and is an important regulatory factor of grasses in the iron reaction, to be responsible for regulation of the key genes involved in Fe absorption. Under iron deficiency conditions, OsIRO2 is an indispensable factor for effective absorption to iron. In plants of OsIRO2 RNAi, due to the expression of OsIRO2 declining, the synthesis of mugineic acid is decreased. Meanwhile, the secretion of 2'-deoxy mugineic acid is reduced, resulting in a decrease of iron absorption, so that the iron content in the plants drops, leaves yellowing and its growth is inhibited. Under conditions of iron deficiency, unknown transcription factor binds into the promoter of iron deficiency OsIRO2 response cis-acting elements (IDE), to adjust the expression of OsIRO2, then OsIRO2 binds to the related gene or promoter sequences which is CACGTGG about iron absorption, regulating the expression of these genes, and promoting the absorption of iron in rice under iron deficiency conditions.
| + | * rice bHLH proteins can potentially participate in a variety of combinatorial interactions, endowing them with the capacity to regulate a multitude of transcriptional programs. |
| | + | * bHLHs represent key regulatory components in transcriptional networks controlling a number of biological processes. |
| | + | * Plant bHLHs have been reported to function in light signaling, hormone signaling, wound and drought stress responses, symbiotic ammonium transport, shoot branching, root, fruit and flower development, et al. <ref name="ref1" /> <ref name="ref2" /> <ref name="ref3" /> |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − |
| + | * Similar expression patterns suggest functional conservation between some rice bHLH genes and their close Arabidopsis homologs. |
| − | Spatial pattern of OsIRO2 expression. During germination, OsIRO2 expression was detected in embryos[fig 1]. OsIRO2 expression in vegetative tissues was restricted almost exclusively to vascular bundles of roots[[Media:Fig 2]] and leaves[[Media:Fig 3]], and to the root exodermis under Fe-sufficient conditions, and expanded to all tissues of roots and leaves in responseto Fe deficiency. OsIRO2 expression was also detected inflowers and developing seeds[fig4]. Plants overexpressing OsIRO2 grew better, and OsIRO2-repressed plants showed poor growth compared to non-transformant rice after germination.[OsIRO2 is responsible for iron utilization in rice and improves
| |
| − | growth and yield in calcareous soil]
| |
| − | | |
| − | | |
| − |
| |
| − | In the iron-sufficient conditions, there is no significant difference between the plants of overexpression ''OsIRO2'' and ''OsIRO2'' RNAi and wild type of
| |
| − | plants; under iron deficiency conditions, the growth of ''OsIRO2'' RNAi plants is inhibited, their leaves yellowing, while the growth of ''OsIRO2'' overexpression plants can continue, and plant height is higher than that of wild-type and ''OsIRO2'' RNAi plants[[2]].
| |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Please input evolution information here.
| + | * The studies of researchers indicate that the ancient bHLH gene family has likely expanded considerably during flowering plant evolution to include many relatively young members, allowing both the conservation and divergence of gene function. |
| | | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Institute of Crop Science, Chinese Academy of Agricultural Sciences | + | * Shanghai Jiao Tong University-Shanghai Institutes for Biological Sciences-Pennsylvania State University Joint Center for Life Sciences, Key Laboratory of Microbial Metabolism, Ministry of Education, School of Life Science and Biotechnology, Shanghai Jiao Tong University, Shanghai, People’s Republic of China, 200240 |
| | + | * School of Life Science, Shanghai University, Shanghai, People’s Republic of China, 200444 |
| | + | * School of Life Science, Xiamen University, Xiamen, People’s Republic of China, 361005 |
| | + | * Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai, People’s Republic of China, 200032 |
| | + | * Department of Biology and the Huck Institutes of the Life Sciences, Pennsylvania State University, University Park, Pennsylvania 16802 |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| − | 1. Yuko Ogo;Reiko Nakanishi Itai;Hiromi Nakanishi;Haruhiko Inoue;Takanori Kobayashi;Motofumi Suzuki;Michiko Takahashi;Satoshi Mori;Naoko K. Nishizawa. Isolation and characterization of IRO2, a novel iron-regulated bHLH transcription factor in graminaceous plants. Journal of Experimental Botany, 2006, 57(11): 2867-2878.
| + | * <ref name="ref1"> |
| − | 2. Yuko Ogo;Reiko Nakanishi Itai;Hiromi Nakanishi;Takanori Kobayashi;Michiko Takahashi;Satoshi Mori;Naoko K. Nishizawa. The rice bHLH protein OsIRO2 is an essential regulator of the genes involved in Fe uptake under Fe-deficient conditions. The Plant Journal, 2007, 51(3): 366-377.
| + | Li X, Duan X, Jiang H, Sun Y, Tang Y, Yuan Z, Guo J, Liang W, Chen L, Yin J, |
| − | | + | Ma H, Wang J, Zhang D. Genome-wide analysis of basic/helix-loop-helix |
| − | ==Structured Information== | + | transcription factor family in rice and Arabidopsis. Plant Physiol. 2006 |
| − | {{JaponicaGene|
| + | Aug;141(4):1167-84. PubMed PMID: 16896230; PubMed Central PMCID: PMC1533929. |
| − | GeneName = Os01g0952800|
| + | </ref> |
| − | Description = Basic helix-loop-helix dimerisation region bHLH domain containing protein|
| + | * <ref name="ref2"> |
| − | Version = NM_001051959.1 GI:115442288 GeneID:4325750|
| + | Carretero-Paulet L, Galstyan A, Roig-Villanova I, Martínez-García JF, |
| − | Length = 6650 bp|
| + | Bilbao-Castro JR, Robertson DL. Genome-wide classification and evolutionary |
| − | Definition = Oryza sativa Japonica Group Os01g0952800, complete gene.|
| + | analysis of the bHLH family of transcription factors in Arabidopsis, poplar, |
| − | Source = Oryza sativa Japonica Group
| + | rice, moss, and algae. Plant Physiol. 2010 Jul;153(3):1398-412. doi: |
| | + | 10.1104/pp.110.153593. PubMed PMID: 20472752; PubMed Central PMCID: PMC2899937. |
| | + | </ref> |
| | + | * <ref name="ref3"> |
| | + | Feller A, Machemer K, Braun EL, Grotewold E. Evolutionary and comparative |
| | + | analysis of MYB and bHLH plant transcription factors. Plant J. 2011 |
| | + | Apr;66(1):94-116. doi: 10.1111/j.1365-313X.2010.04459.x. Review. PubMed PMID: |
| | + | 21443626. |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| + | </ref> |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| + | </references> |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| + | <br> |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
| |
| − | AP = Chromosome 1:43766291..43772940|
| |
| − | CDS = 43770559..43770642,43771987..43772343,43772434..43772736|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008394:43766291..43772940
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>| | |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008394:43766291..43772940
| |
| − | source=RiceChromosome01
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>| | |
| − | CDNA = <cdnaseq>atggagcagctgttcgtcgacgacccagccttcgcgagcagcatgtcgtcgcttgaggcggacatcttctccggcgccggccagctgccgtcctcgccgtggctggacctagacctcgacgacgatgtccaagacctctccatggcgccgacgacggcgaacgcggtgtcctccggctacggctccggcggatccggctcccacaggaagctcagccacaacgcctacgagcgcgaccgccggaagcagctcaacgagctctactcctccctccgcgctctcctccccgacgccgatcacactaagctgagcatcccgacgacggtgtctcgcgtgctcaagtacatacccgagctgcagaagcaggtggagaatctggagaggaagaagaaggagctgacgacgacgagcaccaccaactgcaaaccaggagtgttggggagccagctgatgagcgagggcatggctcccatcgtttcggctacctgcatcaatgacatggagatcatggttcaggtcagcttgttgagcaatgtggcgggttcagttcttcctctctccaagtgtatcaaagtactggagaacgaaggtcttcacttcatcagttcatcgacttcctccggatttgggaacaggacattctacagtatccatcttcagagaagtgaaggaacgatcaacgaggagtgcccagcattttgtgaaaggttggagaaagtcgtcaggaacaaagcaaagctttaa</cdnaseq>|
| |
| − | AA = <aaseq>MEQLFVDDPAFASSMSSLEADIFSGAGQLPSSPWLDLDLDDDVQ DLSMAPTTANAVSSGYGSGGSGSHRKLSHNAYERDRRKQLNELYSSLRALLPDADHTK LSIPTTVSRVLKYIPELQKQVENLERKKKELTTTSTTNCKPGVLGSQLMSEGMAPIVS ATCINDMEIMVQVSLLSNVAGSVLPLSKCIKVLENEGLHFISSSTSSGFGNRTFYSIH LQRSEGTINEECPAFCERLEKVVRNKAKL</aaseq>|
| |
| − | DNA = <dnaseqindica>2299..2382#598..954#205..507#gctggcctaagctaactcaatcaaacctccctagcttggcagaatagttaatgttaatcacctgattaaaattagattagtcccctcctacccagctaactactgcttctatttcacggagaaaaatgtcttcctaggctttctctttcagctcgatcgatccacagctcagctagctctctctctctctagcgacaagcaagcatggagcagctgttcgtcgacgacccagccttcgcgagcagcatgtcgtcgcttgaggcggacatcttctccggcgccggccagctgccgtcctcgccgtggctggacctagacctcgacgacgatgtccaagacctctccatggcgccgacgacggcgaacgcggtgtcctccggctacggctccggcggatccggctcccacaggaagctcagccacaacgcctacgagcgcgaccgccggaagcagctcaacgagctctactcctccctccgcgctctcctccccgacgccgatcacactgtaatttaatttacacaaaaccaatcaaatccagtacaccaaattaaccatgcatatgcatgagatcttgatgtgattttgctgcagaagaagctgagcatcccgacgacggtgtctcgcgtgctcaagtacatacccgagctgcagaagcaggtggagaatctggagaggaagaagaaggagctgacgacgacgagcaccaccaactgcaaaccaggagtgttggggagccagctgatgagcgagggcatggctcccatcgtttcggctacctgcatcaatgacatggagatcatggttcaggtcagcttgttgagcaatgtggcgggttcagttcttcctctctccaagtgtatcaaagtactggagaacgaaggtcttcacttcatcagttcatcgacttcctccggatttgggaacaggacattctacagtatccatcttcaggtacacattatacacacagctctatgctagaacgtttaattaatatttcttatggtaatatatttttgaaaagaaaatccctctatactatctccattctaaaatataaaaacatagagcccggacagactgtctatccagatttgtagtacgagtaattaaatgtctcatacgattctattaggttttttatattttagaatggatggagtattttcgatcaacaataacctagcatcaaatcaaggactagagtcaggttaagatccgggtaaattagataaagggtgctatagtacaatctagtgatactactactctgccttaaaatagtttctttttagctatttactcgtatatataccactgttcaagttcataactaaacatataggttttttaagatgaaggtagtagtaaatatgagtaaattttatacaactatgagtatattgaataatattatagaactatacttttatatagcacactgtcataaaattagagacttaatactacacatttaaaccacaataacacgaactatatagttgtatatatggcacaaatctagtatagaatatatcatagaactacatattttaataagccatggatctagtaacacaaattacagatttaaatagtggtaaattttattaaaagttatatatattctaaaatttctatcgaaacaacaatgttagctagggatctactatttacaaattacaatatactattttgcaacaaatttgatgctaggtccatagtttttcataggtggtttaatcttgcaaaattgaaaaaacttgtggcaaatttgcaaatgcccctttaatctaccgtttatgctcatagtttgatgttcaatccataattatgtaatattttgcatagtaacagatgagagaaattataagtgaataagatgaaattctactataatcatgagagatatagtagtccctgaatcgtgtgtggaattcatcagctagttgtttttaagatttcaattagagctgaccttcttatgataaaaaccaatgtttcttagtcacaaatctcaaaatatacttgttaaatcgaagatatatgaatcacatgataattgtaaaaatatatgtagcgttactcatgatactaatacttgagataaccctctaaaaatacgggatattacatatgaaagtttctccttgtttgggttaaaattgacagtagagcatgtttgtgtgtatatatagcgtacaattagaccgttatttagttgtcatagaagttcggtgttctgaaaattactcacagttttcatttatatatatgtatctaatgttgaaacagagaagtgaaggaacgatcaacgaggagtgcccagcattttgtgaaaggttggagaaagtcgtcaggaacaaagcaaagctttaagcactagtaccgcgcgcgcgtgcctatgataatcctgaattaatcaagggccaaaatctaggtaaaaatgaccatgcgcagttgttaaatatagcatttggttagctgataataatgatatataagtagtgtgctcgatttatattaactaatttctatgacatatatactatgttgctcgatgtagcttttgtacatatttcatgcatgactctcagtgtattaattaattatattatgagatttgcaaaatgttaatttttgcaatgcttaacgttgctggaggaaaatcaaaccttaagaatatattactttcgtccgctaatataagggattttgacattttacttgtactgtttggccattcgtgttattcaaaaaaatttagaattattatttattttatttgtgacttactttattatccaaagtactttaagcacaacttctctttttttatatttgcacaatttttttaaataagacgagtggtcaaacagtgcaaacaaaatgtcaaaaatcccttatattaggggacggccggagggagtaagtatgtttccggacatgctatatatcactcgacatattttaaagagagatcatacgaatttctaatcttaagatctacttcacgacctccttctccagctttgacaaactctaccgagctccctagtggtcaattagctagggttgtggagtgggtggtgttccacggtttatagggatgctaattaatctactccctccgtccctaaatattttgacgtcgttgacttctaaatatgtttaaccattcgtcttaatcaaaaaatttaagtaattattaattctttttctatccttcgattcaatgttaaatatacttttatgtatacatatagttttacatatttcataaaagttttttaataagacaaacagttaaacatgtttaaaaaagtcaacggcgataaatatttagggacggatggagtatatttttgcgcaagttatgggaggaaaatatgaggacgcacatcctgaagagtacttaaaagaagataatgcatgcaaatacactgcaacctgcatccatggattaattgggatcttattttttcgcttatgcttatgcttatcaaccaaaatttaaattttcaatcttaaatttggatctaattttgatagttttttcattaaagtttatttttcagcctttgcttttagatcgctaagaatacatatataaaagttttattcacaaattatttttcgtttgtaaatatgtcgtttggcttatttcacgaataagcgaaacaatgacgctcttggattcttctccttaggtactactctctctattctaaaatgtggtgtactactagtatttcatctgaaaattaaccgagcaccagctgacagtacttgcacatctacattacagtatgtactagcagaagtaaatgtacttgcgcgctctgtactagcaaccaggagcaagctgatcgtactcacatgcaacaagtttgtggataaggcgtactcctacgtttttgcagttaattaacataaatagggcgagagaggaggattagtgtaattatatatgcaaagactaaagacctttcctgcaaatatttctgaggatgtcgaaggtgttatcaaaaagtgtcttttccattgcaattccagactaggcacaaattaaatttcgtaggctttgggggctttctgcgtgttatgaggaccaataatgaggtctcatcctagctaatttgctgaaatcggccgagatcttatagcagaccatatggaccgcatcatagcatgaactatgcttaggtttggctcttactttaaccgggtaaagagttgaatcgtaccaaacatgtcacgagccacatccaaatttgatttttttttcgcaaacgtgcaaaaaaattgcacgtcaatatattagaagaagagagcatagtttaattacacaacacacacggtcagaaggccgttgccaggggtcaaagaaaaaaagaaaaaaaacagataagctactaagaaagtaaaaactcatatcgcaagagagggtggggtagggggtcctactacactctggcctgcgccagaggcagcgagtcggagaagagagaagagaaggtcattgcgtgatctggagggaggggttgagagaagaggccgttgtaagccgcaacagcctcagttgacacaggacccttctcagacaccattccaagcttgcgcttcagattgtgctaggcgcgtgaggtcatgtcactcgggcaggcgagcgcgagcttggccgcaatcctcttgctacttttcggcacttcttccacggtggcatgcaattcgtggatccggtggcactaatacagttttgagatttcgtggatgatttcatctaaatgaagtccaggatctggtggcgattctatctatattgaagtccatgacatttatactctctttgtttcagactataaattcattttgactttagtcaaagtcaaactactttaagtttagttaagtttataaagagatatagtactcatatttacagcaccaaattagtttcattaaatcaataattgaatatatttatcttgggctaaaatgttactattttttcattaaacttaattaaacttaaaacaatttaactttgacaaaaaccacaatgacttatagtctgaaatggaggaagtatcgtttaatttgagactttgaatacttaatttacaaagaagtgtgtatttgtgccgtgttttctcgctctatatatatcgcagtttcacccatctaattagttgaacagtgcgtcttaatctcaatctccattcgccaattgactgtacatgtctgaatggaatccttctatgtattatctgcacagctagaatcctacaactagcgtagtgtggtggtggtcgtcttcgagttcgacgcgccgccgccgccgctcatcgcgacgacaagagcctcgccagcgtccgcagtagcagcttcctagtcttgttgcactccgagatcgtctccagcctcggcgaccacggctggttcctccgccccatcagcagcgcgtaatgccgcttcagctccggcgtgctgcacagctccgtcgccgtcgccgtcgccgtcgtcgacggcttccggcggcgcgcaccgccgccgttctcgtcgcagctgatcaccttctcgatgaactccgggaggactcggatgagcgtggcgccgccctcgcccttgacgtactcgaacgggcactgccccggcccagccacggacacctttttcgacggcgccggcgacagcgacgcgagcgccgcggcggtgagcaccttgaagcaggagaagcgctcggcggggaggacgaagtacgtccgccccgccatcagctcctcgccggcggacaccaccgggatcgggaggccgacgtagaaggagtcggccgcgcagacgacgtggtcaccggggagctccgccgtgacgtcccccgccacggcgcacaccccgccatcgtcgtccagcatcctcgtctgcccgccccagtacaccagcttcacccccgccgccgccgtcgccggcaggtgcatgcacggggagaggccgttgcccatggcaactgatgtgtctagaaccttctagaacgagctcgagcttgcagatggaagaagaggagaagaggagatgcttgtgtgaattggggctcgtggttgcgagaggggaatatatataagcgagcgttgaacggggttgactttggaaaattcaaagatggaggaggtaaatactcctactactactggtctggcttggtcagcggtcaaaggcgatggcttttgagacggaagcgggtcacgtggcagctgccgattgggccgcggagggggagaagcgagttgcgcgtgcgcatcgtcgttggtcggtgtcgccgatcgggttggatccaaccagatattcagaatttcagatcagatgcacagtagtacagttgcaagttgcaactagaagttgccgattaatttgacagcgcctggctgcaggctgctaccgcactccaacgccgacatggcaggtgtttttttttaaaaatcttgttccaaatttggagctgactgaagagagttttatactccgtattatgggtatgagttcatttatactcctatgtcacttatcatcgatttgttttcggacttattcactttgtagctattttcaaccattacaaaatttaacaattcccataattttagcaaatt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051959.1 RefSeq:Os01g0952800]|
| |
| − | }}
| |
| − | [[Category:Genes]]
| |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]]
| |
| − | [[Category:Japonica Genes]]
| |
| − | [[Category:Japonica Chromosome 1]]
| |
| − | [[Category:Chromosome 1]]
| |