|
|
| (One intermediate revision by one other user not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''Os02g0659100''' was reported as '''''ZOS2-13''''' in 2007 <ref name="ref1" /> by researchers from the India. It is a member of C2H2 transcription factor gene family. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os02g0659100''''' '''''<=>''''' '''''ZOS2-13''''' |
| | + | |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | * The Cys 2/His 2 zinc-finger proteins (ZFPs) constitute one of the largest transcription factor class regulatory protein families in eukaryotes. <ref name="ref1" /> <ref name="ref2" /> |
| − | | + | * The classical C2H2 zinc finger domain is involved in a wide range of functions and can bind to DNA, RNA and proteins. |
| − | ===Expression===
| + | * Plant Q-type C2H2 zinc finger transcription factors play an important role in plant tolerance to various environmental stresses such as drought, cold, osmotic stress, wounding and mechanical loading. |
| − | Please input expression information here.
| + | * The ZFPs not only interact with DNA or chromatin but their interactions with RNA and other proteins are also well documented in lower as well as higher eukaryotes. |
| − | | |
| − | ===Evolution===
| |
| − | Please input evolution information here.
| |
| − | | |
| − | You can also add sub-section(s) at will.
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi 110021, India |
| | + | * Division of Genetics, Indian Agricultural Research Institute, New Delhi 110012, India |
| | + | * Plant Disease Resistance Research Unit, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba 305-8602 Ibaraki, Japan |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| | + | * <ref name="ref1"> |
| | + | Xu H, Watanabe KA, Zhang L, Shen QJ. WRKY transcription factor genes in wild |
| | + | rice Oryza nivara. DNA Res. 2016 Aug;23(4):311-23. doi: 10.1093/dnares/dsw025. |
| | + | PubMed PMID: 27345721; PubMed Central PMCID: PMC4991837. |
| | + | </ref> |
| | + | * <ref name="ref2"> |
| | + | Englbrecht CC, Schoof H, Böhm S. Conservation, diversification and expansion |
| | + | of C2H2 zinc finger proteins in the Arabidopsis thaliana genome. BMC Genomics. |
| | + | 2004 Jul 5;5(1):39. PubMed PMID: 15236668; PubMed Central PMCID: PMC481060. |
| | + | </ref> |
| | + | |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]] |
| − | GeneName = Os02g0659100|
| |
| − | Description = Zinc finger, C2H2-type domain containing protein|
| |
| − | Version = NM_001054175.1 GI:115447720 GeneID:4330215|
| |
| − | Length = 2349 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os02g0659100, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
| |
| − | AP = Chromosome 2:27555657..27558005|
| |
| − | CDS = 27555737..27557596|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008395:27555657..27558005
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008395:27555657..27558005
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcgatggtcgtcgcggggagccatcggccgccgccgccgccgcagtcgctgcggctggtcccgccaccgccgccgcagcctcctcctcctcctctgacgtacaggcaccactgcaaggtgtgcaagaaggggttcatgtgcggtcgcgcgctcggcggccacatgagggcgcacggcatcggcgacgacaacgacacgatggacgacgacgacggccgcgatgatgatcattcgctgtcaccgtgcgatggtggtggcgagccgtcggaggcagccgggagcccgacgacgacgacgacgaaacgtatgtacgcgctgcggaccaatcccgggcggccaaggaactgcaggacatgcgagaactgcgggaaggagttcacgtcgtggaagacgttgctggatcatggcaggtgcggccttgacgaggaggacggtcgcctcgacgtctcgctccgttcgccgccgcttcacgacggtggcgacgaaaacgacggcgaggaggaggaggagggggacgacctcacactggctgcgggcgggtggtcgaaagggaagcgctcgcgccgtgctaaagtgatggccgtcgggaccggctccgtgtccgagctacagctgccggctccgtctaccgaagaggaagacctcgccaactttctcgtgatgctctcttcttcttcgtcatcatcgtcgcgtgttgcacagccagccatcgtcgtcgacgacgcggaccaagagtcctgcgcatcaggtagcaaggacgaggagaggaacaggttcttggtgccgcagccaatctcgatggcagcccccatgatggctcagatgacagtgatcgctccgcaagtggtgccacagcacatctcgaccgtgccacgtggcatgttcgagtgcaaggcatgcaagaaggtgtttacatcgcaccaggctcttggcgggcaccgtgccagccacaagaaggtgaaaggatgcttcgccgcgaagctcgagagcagccgcaacgagactagtcagactcagactcagcagcaacacgtctcagccgctcctcatgacaataccagggccaccacctctcatgtcatcaccagcgatatcagcatggatgcaaacacgatcggtgccagtgctgatgctgacggcaaggcagcggcaagcggcgttggcgcaggtgaaattgtcctcgccggagcttcgtcgacggatatggccatgatgatgtcggtcgaggacttcgcgccgacaccgttggcgccatccgccgtctcaccgttcaagaagaaggggaaggtgcacgagtgctccatctgccaccgggtgttcacgtcggggcaagcgctcggcggccacaagcgatgccactggctgacgtcgggcgcaacggacccgctcacgaagctccagcccgtcgcccaagaccacgccatgatggccgccatgtgccaccagctcacgctcgggcgcccaatattcgaccctaccgaccagcggatactagaccttaacgtgccgacgaacccactggcagaagcggtcgcggccaggcagcagcagcagcagcaggtcgccgctctcaacgacggcgcactctgcctcaacgcggcggcgtcggtgtacctgcagtcctggacagggcacagcaacgggagccacgtgaacaagaccaccgcgacgagcagccgcatcaacgacgcggccggcggcgtgaccacggaggacgatgaagcggacagcacgagcgccaagagagccaagatcggcgacctcaaggacatgaaagtggcaggggagtcgttgccctggctgcaggttggcatcggaatttcatcagagagcaaagaaaagaacactcaagagtga</cdnaseq>|
| |
| − | AA = <aaseq>MAMVVAGSHRPPPPPQSLRLVPPPPPQPPPPPLTYRHHCKVCKK GFMCGRALGGHMRAHGIGDDNDTMDDDDGRDDDHSLSPCDGGGEPSEAAGSPTTTTTK RMYALRTNPGRPRNCRTCENCGKEFTSWKTLLDHGRCGLDEEDGRLDVSLRSPPLHDG GDENDGEEEEEGDDLTLAAGGWSKGKRSRRAKVMAVGTGSVSELQLPAPSTEEEDLAN FLVMLSSSSSSSSRVAQPAIVVDDADQESCASGSKDEERNRFLVPQPISMAAPMMAQM TVIAPQVVPQHISTVPRGMFECKACKKVFTSHQALGGHRASHKKVKGCFAAKLESSRN ETSQTQTQQQHVSAAPHDNTRATTSHVITSDISMDANTIGASADADGKAAASGVGAGE IVLAGASSTDMAMMMSVEDFAPTPLAPSAVSPFKKKGKVHECSICHRVFTSGQALGGH KRCHWLTSGATDPLTKLQPVAQDHAMMAAMCHQLTLGRPIFDPTDQRILDLNVPTNPL AEAVAARQQQQQQVAALNDGALCLNAAASVYLQSWTGHSNGSHVNKTTATSSRINDAA GGVTTEDDEADSTSAKRAKIGDLKDMKVAGESLPWLQVGIGISSESKEKNTQE</aaseq>|
| |
| − | DNA = <dnaseqindica>81..1940#agcgatcgatctcgaccgcaccggccccgcatgcctgcccactgcccaaataaagcgtcgtcgatcgaccgcgcgcgatcatggcgatggtcgtcgcggggagccatcggccgccgccgccgccgcagtcgctgcggctggtcccgccaccgccgccgcagcctcctcctcctcctctgacgtacaggcaccactgcaaggtgtgcaagaaggggttcatgtgcggtcgcgcgctcggcggccacatgagggcgcacggcatcggcgacgacaacgacacgatggacgacgacgacggccgcgatgatgatcattcgctgtcaccgtgcgatggtggtggcgagccgtcggaggcagccgggagcccgacgacgacgacgacgaaacgtatgtacgcgctgcggaccaatcccgggcggccaaggaactgcaggacatgcgagaactgcgggaaggagttcacgtcgtggaagacgttgctggatcatggcaggtgcggccttgacgaggaggacggtcgcctcgacgtctcgctccgttcgccgccgcttcacgacggtggcgacgaaaacgacggcgaggaggaggaggagggggacgacctcacactggctgcgggcgggtggtcgaaagggaagcgctcgcgccgtgctaaagtgatggccgtcgggaccggctccgtgtccgagctacagctgccggctccgtctaccgaagaggaagacctcgccaactttctcgtgatgctctcttcttcttcgtcatcatcgtcgcgtgttgcacagccagccatcgtcgtcgacgacgcggaccaagagtcctgcgcatcaggtagcaaggacgaggagaggaacaggttcttggtgccgcagccaatctcgatggcagcccccatgatggctcagatgacagtgatcgctccgcaagtggtgccacagcacatctcgaccgtgccacgtggcatgttcgagtgcaaggcatgcaagaaggtgtttacatcgcaccaggctcttggcgggcaccgtgccagccacaagaaggtgaaaggatgcttcgccgcgaagctcgagagcagccgcaacgagactagtcagactcagactcagcagcaacacgtctcagccgctcctcatgacaataccagggccaccacctctcatgtcatcaccagcgatatcagcatggatgcaaacacgatcggtgccagtgctgatgctgacggcaaggcagcggcaagcggcgttggcgcaggtgaaattgtcctcgccggagcttcgtcgacggatatggccatgatgatgtcggtcgaggacttcgcgccgacaccgttggcgccatccgccgtctcaccgttcaagaagaaggggaaggtgcacgagtgctccatctgccaccgggtgttcacgtcggggcaagcgctcggcggccacaagcgatgccactggctgacgtcgggcgcaacggacccgctcacgaagctccagcccgtcgcccaagaccacgccatgatggccgccatgtgccaccagctcacgctcgggcgcccaatattcgaccctaccgaccagcggatactagaccttaacgtgccgacgaacccactggcagaagcggtcgcggccaggcagcagcagcagcagcaggtcgccgctctcaacgacggcgcactctgcctcaacgcggcggcgtcggtgtacctgcagtcctggacagggcacagcaacgggagccacgtgaacaagaccaccgcgacgagcagccgcatcaacgacgcggccggcggcgtgaccacggaggacgatgaagcggacagcacgagcgccaagagagccaagatcggcgacctcaaggacatgaaagtggcaggggagtcgttgccctggctgcaggttggcatcggaatttcatcagagagcaaagaaaagaacactcaagagtgacctggtcatgacaaggaggtcatgccgactaatgaactaagaaattaattaattaattaattagtgctaatctaatccatatatatatatacatattgtaggtgtacgtactatatcaatgctttatgtgatcgggatatatgtatgtgtatatacatccaatgtaagtatttacaagtagggtcaattcatgtgttcctaaaggtttgaggcaacatctagggacgtattgcttgggggactgtaaattaataggctagcaagcttgattctaaaaggtttccttactgtacgattctttgaggagccttgctttttatttttatttttttccttttattttttctattttgtaactaaccgattatttaatttgctgcttccaaaatgtatatatgcaagttgattt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054175.1 RefSeq:Os02g0659100]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 2]]
| |
| − | [[Category:Chromosome 2]]
| |