Difference between revisions of "Os02g0659500"

From RiceWiki
Jump to: navigation, search
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''Os02g0659500''' was reported as '''''ZOS2-14''''' in 2007 <ref name="ref1" /> by researchers from the India. It is a member of C2H2 transcription factor gene family.
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os02g0659500''''' '''''<=>''''' '''''ZOS2-14'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* The Cys 2/His 2 zinc-finger proteins (ZFPs) constitute one of the largest transcription factor class regulatory protein families in eukaryotes. <ref name="ref1" /> <ref name="ref2" />
 
+
* The classical C2H2 zinc finger domain is involved in a wide range of functions and can bind to DNA, RNA and proteins.  
===Expression===
+
* Plant Q-type C2H2 zinc finger transcription factors play an important role in plant tolerance to various environmental stresses such as drought, cold, osmotic stress, wounding and mechanical loading.  
Please input expression information here.
+
* The ZFPs not only interact with DNA or chromatin but their interactions with RNA and other proteins are also well documented in lower as well as higher eukaryotes.
 
 
===Evolution===
 
Please input evolution information here.
 
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi 110021, India
 +
* Division of Genetics, Indian Agricultural Research Institute, New Delhi 110012, India
 +
* Plant Disease Resistance Research Unit, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba 305-8602 Ibaraki, Japan
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Xu H, Watanabe KA, Zhang L, Shen QJ. WRKY transcription factor genes in wild
 +
rice Oryza nivara. DNA Res. 2016 Aug;23(4):311-23. doi: 10.1093/dnares/dsw025.
 +
PubMed PMID: 27345721; PubMed Central PMCID: PMC4991837.
 +
</ref>
 +
* <ref name="ref2">
 +
Englbrecht CC, Schoof H, Böhm S. Conservation, diversification and expansion
 +
of C2H2 zinc finger proteins in the Arabidopsis thaliana genome. BMC Genomics.
 +
2004 Jul 5;5(1):39. PubMed PMID: 15236668; PubMed Central PMCID: PMC481060.
 +
</ref>
 +
 
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
GeneName = Os02g0659500|
 
Description = Zinc finger, C2H2-type domain containing protein|
 
Version = NM_001054176.1 GI:115447722 GeneID:4330217|
 
Length = 1475 bp|
 
Definition = Oryza sativa Japonica Group Os02g0659500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:27576287..27577761|
 
CDS = 27576417..27577442|
 
GCID = <gbrowseImage1>
 
name=NC_008395:27576287..27577761
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:27576287..27577761
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgaagaacgcatgcaagctctgctaccgccgcttcgctagcccacgcgccctcgcggggcacatgcggtctcactctgtggcggccgccaacgcagccgcggctgcggcggcggccgcagccgcgaagctgcagatctcatcggcgtcgtccgcgtcgacgtcgttcaccgcggccgatgaggaggaggaggaggaggaggaagaggaggacgtgggattcaagaagcccctttccatctacgcgctccgggagaatcccaagcgcagcctccgcgtctccgagtacgcgttctccgaccgcgagagcgaggccgagtccaccccgacgcccgcagccaagggcttacgcgccggcggcggcggcggcggcggcgatggcgagcccatgagctcgttgtcgtacgcgggaacgccggaggaggaggtggcgctggccctcatgatgctctcccgcgacacctggccgtccgtcgagcgcggtggcggcgggggcgagtactcggacgacgggagcgacgacggctacgcgctccctccgccgtctcccgctccggcgccggcgccggtgccggagaagcggacgcggttccagtgccccgcgtgcaagaaggtgttccggtcctaccaggcgctcggcggccaccgcgccagccacgtccgcggcggcaggggcggctgctgcgcgcctcccgtcgctcctccccctcagccgcatccgcagccgccattgccggagcacgacgcgggcgaggaagacatggacgggaaggcgccgccgcacgagtgcccctactgctaccgcgtgttcgcctccgggcaagctctgggcggccacaagaagtctcacgtctgctccgccgccgccgccgcggcccatgcacagacacccggcggcggcgctcctccgccccagcccaaaattctcggcatgatcgatctcaacttcgcgccgcccgtggatgaggtggagctctccgccgtgtcagatccccacttcccctccaatccaccaggtccttga</cdnaseq>|
 
AA = <aaseq>MAKNACKLCYRRFASPRALAGHMRSHSVAAANAAAAAAAAAAAK                    LQISSASSASTSFTAADEEEEEEEEEEDVGFKKPLSIYALRENPKRSLRVSEYAFSDR                    ESEAESTPTPAAKGLRAGGGGGGGDGEPMSSLSYAGTPEEEVALALMMLSRDTWPSVE                    RGGGGGEYSDDGSDDGYALPPPSPAPAPAPVPEKRTRFQCPACKKVFRSYQALGGHRA                    SHVRGGRGGCCAPPVAPPPQPHPQPPLPEHDAGEEDMDGKAPPHECPYCYRVFASGQA                    LGGHKKSHVCSAAAAAAHAQTPGGGAPPPQPKILGMIDLNFAPPVDEVELSAVSDPHF                    PSNPPGP</aaseq>|
 
DNA = <dnaseqindica>131..1156#atccactgcgtgcgtttgtaacttcctccgcagctatctcccttgctctcgccatctcgccattctagctcccgcaaagctctccccccccgaggcgagctctctctgctcccgagcgagagctctcgccatggcgaagaacgcatgcaagctctgctaccgccgcttcgctagcccacgcgccctcgcggggcacatgcggtctcactctgtggcggccgccaacgcagccgcggctgcggcggcggccgcagccgcgaagctgcagatctcatcggcgtcgtccgcgtcgacgtcgttcaccgcggccgatgaggaggaggaggaggaggaggaagaggaggacgtgggattcaagaagcccctttccatctacgcgctccgggagaatcccaagcgcagcctccgcgtctccgagtacgcgttctccgaccgcgagagcgaggccgagtccaccccgacgcccgcagccaagggcttacgcgccggcggcggcggcggcggcggcgatggcgagcccatgagctcgttgtcgtacgcgggaacgccggaggaggaggtggcgctggccctcatgatgctctcccgcgacacctggccgtccgtcgagcgcggtggcggcgggggcgagtactcggacgacgggagcgacgacggctacgcgctccctccgccgtctcccgctccggcgccggcgccggtgccggagaagcggacgcggttccagtgccccgcgtgcaagaaggtgttccggtcctaccaggcgctcggcggccaccgcgccagccacgtccgcggcggcaggggcggctgctgcgcgcctcccgtcgctcctccccctcagccgcatccgcagccgccattgccggagcacgacgcgggcgaggaagacatggacgggaaggcgccgccgcacgagtgcccctactgctaccgcgtgttcgcctccgggcaagctctgggcggccacaagaagtctcacgtctgctccgccgccgccgccgcggcccatgcacagacacccggcggcggcgctcctccgccccagcccaaaattctcggcatgatcgatctcaacttcgcgccgcccgtggatgaggtggagctctccgccgtgtcagatccccacttcccctccaatccaccaggtccttgaagcaagaaaaccagacttggcaatggcggagatgatgatctgaggtgaggcataaatcgaagaaacagaaagaataacaaaaagagggaaaaaaaaaagagaagagaaggataaacacaagaacatattttttagccccttagttaatcttctggtcgtaccttttagtattccattccattgatttgtgttcagaatgtttaattaatatgttactaccatgctgttgctttgttttttttttgcctgtttaagctatggaatcgatgtagatttgagcaactgacagtgcaacaagaactagcccctgttcttgatc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054176.1 RefSeq:Os02g0659500]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 13:11, 22 March 2017

The rice Os02g0659500 was reported as ZOS2-14 in 2007 [1] by researchers from the India. It is a member of C2H2 transcription factor gene family.

Annotated Information

Gene Symbol

  • Os02g0659500 <=> ZOS2-14

Function

  • The Cys 2/His 2 zinc-finger proteins (ZFPs) constitute one of the largest transcription factor class regulatory protein families in eukaryotes. [1] [2]
  • The classical C2H2 zinc finger domain is involved in a wide range of functions and can bind to DNA, RNA and proteins.
  • Plant Q-type C2H2 zinc finger transcription factors play an important role in plant tolerance to various environmental stresses such as drought, cold, osmotic stress, wounding and mechanical loading.
  • The ZFPs not only interact with DNA or chromatin but their interactions with RNA and other proteins are also well documented in lower as well as higher eukaryotes.

Labs working on this gene

  • Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi 110021, India
  • Division of Genetics, Indian Agricultural Research Institute, New Delhi 110012, India
  • Plant Disease Resistance Research Unit, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba 305-8602 Ibaraki, Japan

References

  1. 1.0 1.1 Xu H, Watanabe KA, Zhang L, Shen QJ. WRKY transcription factor genes in wild rice Oryza nivara. DNA Res. 2016 Aug;23(4):311-23. doi: 10.1093/dnares/dsw025. PubMed PMID: 27345721; PubMed Central PMCID: PMC4991837.
  2. Englbrecht CC, Schoof H, Böhm S. Conservation, diversification and expansion of C2H2 zinc finger proteins in the Arabidopsis thaliana genome. BMC Genomics. 2004 Jul 5;5(1):39. PubMed PMID: 15236668; PubMed Central PMCID: PMC481060.

Structured Information