Difference between revisions of "Os07g0549600"

From RiceWiki
Jump to: navigation, search
(References)
 
(4 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''Os07g0549600''' was reported as '''''OsbHLH164''''' in 2006 <ref name="ref1" /> by researchers from the China. It is a member of bHLH transcription factor gene family.
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os07g0549600''''' '''''<=>''''' '''''OsbHLH164'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* The basic/helix-loop-helix (bHLH) transcription factors and their homologs form a large family in plant and animal genomes.
The tapetum, the innermost of four sporophytic layers in the anther wall, comes in direct contact with the developing male gametophyte and is thought to play a crucial role in the development and maturation of microspores. UDT1 gene is required for the differentiation of secondary parietal cells to mature tapetal cells and plays a major role in maintaining tapetum development, starting in early meiosis. The transcript is preferentially present in all cell types within the early anthers. This gene is a Major Regulator of Early Anther Development and at the molecular level the meiocyte development is regulated by this gene[1].
+
* rice bHLH proteins can potentially participate in a variety of combinatorial interactions, endowing them with the capacity to regulate a multitude of transcriptional programs.
 +
* bHLHs represent key regulatory components in transcriptional networks controlling a number of biological processes.
 +
* Plant bHLHs have been reported to function in light signaling, hormone signaling, wound and drought stress responses, symbiotic ammonium transport, shoot branching, root, fruit and flower development, et al. <ref name="ref1" /> <ref name="ref2" /> <ref name="ref3" />
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* Similar expression patterns suggest functional conservation between some rice bHLH genes and their close Arabidopsis homologs.
It encodes a predicted protein of 227 amino acids and the protein has an apparent molecular mass of 24.9 kD and a pI of 6.5[1]. The region between the 59th and 118th amino acids is predicted to be a bHLH domain, possessing both the HLH domain required for dimerization and a nearby basic domain necessary for target DNA binding. The promoter region comprises a putative TATA box sequence at 406 bp upstream from the start ATG codon and a CAAT box sequence at -471. The upstream region also contains putative regulatory sequences: GTGA motifs (GTGA) at -485 and -48, responsible for pollen specificity; E-box sequences (CANNTG) At - 845, - 702, and - 205, where the MYC class transcription factors bind; a MYBCORE motif (CNGTTR) at -238, in which a petunia MYB protein involved in the regulation of flavonoid biosynthesis also binds[2]; and a MYBGA motif (TAACAAA) at - 945, at which GAMYB binds.
 
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* The studies of researchers indicate that the ancient bHLH gene family has likely expanded considerably during flowering plant evolution to include many relatively young members, allowing both the conservation and divergence of gene function.
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Shanghai Jiao Tong University-Shanghai Institutes for Biological Sciences-Pennsylvania State University Joint Center for Life Sciences, Key Laboratory of Microbial Metabolism, Ministry of Education, School of Life Science and Biotechnology, Shanghai Jiao Tong University, Shanghai, People’s Republic of China, 200240
National Research Laboratory of Plant Functional Genomics, Division of Molecular and Life Sciences, Pohang University of Science and Technology, Pohang 790-784, Republic of Korea
+
* School of Life Science, Shanghai University, Shanghai, People’s Republic of China, 200444
Center for Plant Intracellular Trafficking and Division of Molecular and Life Sciences, Pohang University of Science and Technology, Pohang 790-784, Republic of Korea
+
* School of Life Science, Xiamen University, Xiamen, People’s Republic of China, 361005
GreenGene Biotech, Myongji University 38-2, Namdong Yongin, Kyonggido 449-728, Republic of Korea
+
* Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai, People’s Republic of China, 200032
Functional Genomic Center, Pohang University of Science and Technology, Pohang 790-784, Republic of Korea
+
* Department of Biology and the Huck Institutes of the Life Sciences, Pennsylvania State University, University Park, Pennsylvania 16802
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
[1] Ki-Hong Jung, Min-Jung Han, Yang-Seok Lee, Yong-Woo Kim, Inhwan Hwang, Min-Jeong Kim, Yeon-Ki Kim, Baek Hie Nahm, and Gynheung An, J.(2005). RiceUndeveloped Tapetum1Is a Major Regulator of Early Tapetum Development. The Plant Cell, Vol. 17, 2705–2722                                                                    [2] Solano, R., Nieto, C., Avila, J., Canas, L., Diaz, I., and Paz-Ares, J.(1995). Dual DNA binding specificity of a petal epidermis-specific MYB transcription factor (MYB.Ph3) from Petunia hybrida.EMBO J.14,1773–1784.
+
* <ref name="ref1">
 +
Li X, Duan X, Jiang H, Sun Y, Tang Y, Yuan Z, Guo J, Liang W, Chen L, Yin J,
 +
Ma H, Wang J, Zhang D. Genome-wide analysis of basic/helix-loop-helix
 +
transcription factor family in rice and Arabidopsis. Plant Physiol. 2006
 +
Aug;141(4):1167-84. PubMed PMID: 16896230; PubMed Central PMCID: PMC1533929.
 +
</ref>
 +
* <ref name="ref2">
 +
Carretero-Paulet L, Galstyan A, Roig-Villanova I, Martínez-García JF,
 +
Bilbao-Castro JR, Robertson DL. Genome-wide classification and evolutionary
 +
analysis of the bHLH family of transcription factors in Arabidopsis, poplar,
 +
rice, moss, and algae. Plant Physiol. 2010 Jul;153(3):1398-412. doi:
 +
10.1104/pp.110.153593. PubMed PMID: 20472752; PubMed Central PMCID: PMC2899937.
 +
</ref>
 +
* <ref name="ref3">
 +
Feller A, Machemer K, Braun EL, Grotewold E. Evolutionary and comparative
 +
analysis of MYB and bHLH plant transcription factors. Plant J. 2011
 +
Apr;66(1):94-116. doi: 10.1111/j.1365-313X.2010.04459.x. Review. PubMed PMID:
 +
21443626.
 +
 
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os07g0549600|
 
Description = Basic helix-loop-helix dimerisation region bHLH domain containing protein|
 
Version = NM_001188319.1 GI:297725768 GeneID:9269572|
 
Length = 1698 bp|
 
Definition = Oryza sativa Japonica Group Os07g0549600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
 
AP = Chromosome 7:22474472..22476169|
 
CDS = 22474473..22474668,22474893..22475089|
 
GCID = <gbrowseImage1>
 
name=NC_008400:22474472..22476169
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008400:22474472..22476169
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>gtcctgaatttcggtggaggtggtgggggagaggaggacggcgacgacggggaggaggagcagcagcagcagcaggcggcggcggcggcgatggggaaggagttcaagtccaagaacctggaggccgagcggcggaggagggggaggctcaacggcaacatcttcgcgctcagggcggtcgtgcccaagatcaccaagatgagcaaggaggccaccttgtcggacgcgatcgaacacatcaagaatctccagaacgaggttcttgagctgcagcgccagctcggcgactcacccggtgaggcttgggagaagcaatgcagcgcgtcctgctctgaatccttcgtccccactgagaacgcccattatcaggtagcagccgctgttctcaagtag</cdnaseq>|
 
AA = <aaseq>VLNFGGGGGGEEDGDDGEEEQQQQQAAAAAMGKEFKSKNLEAER                    RRRGRLNGNIFALRAVVPKITKMSKEATLSDAIEHIKNLQNEVLELQRQLGDSPGEAW                    EKQCSASCSESFVPTENAHYQVAAAVLK</aaseq>|
 
DNA = <dnaseqindica>2..197#422..618#ggtcctgaatttcggtggaggtggtgggggagaggaggacggcgacgacggggaggaggagcagcagcagcagcaggcggcggcggcggcgatggggaaggagttcaagtccaagaacctggaggccgagcggcggaggagggggaggctcaacggcaacatcttcgcgctcagggcggtcgtgcccaagatcaccaaggcaaatgcattcttgagcttcctccccacttttactgaccaccaccagctgattcttgcactgatcatacaaacttcgcataatcagatatgaacctgtttatacttacctaaccctctctcgattctctggaaatcgtgattgcttcaccggggaaaggatttcttgattccggtttgtcattcctgacatgttctgatggttggttttctctgctgttgcagatgagcaaggaggccaccttgtcggacgcgatcgaacacatcaagaatctccagaacgaggttcttgagctgcagcgccagctcggcgactcacccggtgaggcttgggagaagcaatgcagcgcgtcctgctctgaatccttcgtccccactgagaacgcccattatcaggtagcagccgctgttctcaagtagtctatgttttccatcaaagttcacacttcagagagtagtggtctgtactctttagaaccccactgtgcgtccctgggactaattctgaacaaccaatgctgcaatctggaaaatatgatcactcaacttcatacaactttaggcccagattgtttcacaattcgattacatgaagtcgcagtctcgcagacaattggcagatatttgaagctccttaacctttttcgcttaatagacaataaacacacctgaagaagggtgaaaaatctaatccttatttggtttagtagactaatgtccaacttcattgatccacagttagactagccatggacttttgtgagaatttttcaacttacattcagacagagcttgatctcagaaatgacttaacatgaacacaaaaaatattggatacagattcatctatttttctgtgacaaaatttacctctgatatctgattcctcagtctctcaacaatctacatttacacagggtcaggtggaattgatctctcttgggtcatgcaagtataacctgaagatcttctggaccaagagggcaggcctcttcaccaaggtgctggaagcactctgcagctacaaagtgcaagtgctcagcctgaacaccatatccttctacggctacgcagagagtttcttcaccatcgaggtaaactaaatatggccaaaattttcctgctacgacacaagattgcattgcatgtagatttcgctgaactttttaacccattcttgtgagttttagtcttctgataagttggccactcactcctgtctccatctgcaggtgaagggtgagcaggatgttgtgatggtggagctgaggagccttctctccagcattgtggaggttccaagcatctgagacactcctgactacaataaactcacatgactcatgttaagagagcacatatgtttctctggaagaaataattccagtagcagttctctttgtagggagaatacagtggtacatgtttgactgaatgactgatgacatagaagggggaaaaaaggactaaattttgtgttgaaattgagcacagtggcac</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001188319.1 RefSeq:Os07g0549600]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 14:37, 22 March 2017

The rice Os07g0549600 was reported as OsbHLH164 in 2006 [1] by researchers from the China. It is a member of bHLH transcription factor gene family.

Annotated Information

Gene Symbol

  • Os07g0549600 <=> OsbHLH164

Function

  • The basic/helix-loop-helix (bHLH) transcription factors and their homologs form a large family in plant and animal genomes.
  • rice bHLH proteins can potentially participate in a variety of combinatorial interactions, endowing them with the capacity to regulate a multitude of transcriptional programs.
  • bHLHs represent key regulatory components in transcriptional networks controlling a number of biological processes.
  • Plant bHLHs have been reported to function in light signaling, hormone signaling, wound and drought stress responses, symbiotic ammonium transport, shoot branching, root, fruit and flower development, et al. [1] [2] [3]

Expression

  • Similar expression patterns suggest functional conservation between some rice bHLH genes and their close Arabidopsis homologs.

Evolution

  • The studies of researchers indicate that the ancient bHLH gene family has likely expanded considerably during flowering plant evolution to include many relatively young members, allowing both the conservation and divergence of gene function.

You can also add sub-section(s) at will.

Labs working on this gene

  • Shanghai Jiao Tong University-Shanghai Institutes for Biological Sciences-Pennsylvania State University Joint Center for Life Sciences, Key Laboratory of Microbial Metabolism, Ministry of Education, School of Life Science and Biotechnology, Shanghai Jiao Tong University, Shanghai, People’s Republic of China, 200240
  • School of Life Science, Shanghai University, Shanghai, People’s Republic of China, 200444
  • School of Life Science, Xiamen University, Xiamen, People’s Republic of China, 361005
  • Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai, People’s Republic of China, 200032
  • Department of Biology and the Huck Institutes of the Life Sciences, Pennsylvania State University, University Park, Pennsylvania 16802

References

  1. 1.0 1.1 Li X, Duan X, Jiang H, Sun Y, Tang Y, Yuan Z, Guo J, Liang W, Chen L, Yin J, Ma H, Wang J, Zhang D. Genome-wide analysis of basic/helix-loop-helix transcription factor family in rice and Arabidopsis. Plant Physiol. 2006 Aug;141(4):1167-84. PubMed PMID: 16896230; PubMed Central PMCID: PMC1533929.
  2. Carretero-Paulet L, Galstyan A, Roig-Villanova I, Martínez-García JF, Bilbao-Castro JR, Robertson DL. Genome-wide classification and evolutionary analysis of the bHLH family of transcription factors in Arabidopsis, poplar, rice, moss, and algae. Plant Physiol. 2010 Jul;153(3):1398-412. doi: 10.1104/pp.110.153593. PubMed PMID: 20472752; PubMed Central PMCID: PMC2899937.
  3. Feller A, Machemer K, Braun EL, Grotewold E. Evolutionary and comparative analysis of MYB and bHLH plant transcription factors. Plant J. 2011 Apr;66(1):94-116. doi: 10.1111/j.1365-313X.2010.04459.x. Review. PubMed PMID: 21443626.

Structured Information