|
|
| (5 intermediate revisions by 3 users not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''Os03g0782500''' was reported as '''''OsbHLH152''''' in 2006 <ref name="ref1" /> by researchers from the China. It is a member of bHLH transcription factor gene family. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os03g0782500''''' '''''<=>''''' '''''OsbHLH152''''' |
| | + | |
| | ===Function=== | | ===Function=== |
| − | | + | * The basic/helix-loop-helix (bHLH) transcription factors and their homologs form a large family in plant and animal genomes. |
| − | This gene encodes a phytochrome-interacting factor-like protein named ''OsPIL1/OsPIL13''. It acts as a key regulator of reduced internode elongation in rice under drought conditions. ''OsPIL1'' downstream genes, which were enriched for cell wall-related genes responsible for cell elongation. ''OsPIL1'' functions as a key regulatory factor of reduced plant height via cell wall-related genes in response to drought stress. This regulatory system may be important for morphological stress adaptation in rice under drought conditions.
| + | * rice bHLH proteins can potentially participate in a variety of combinatorial interactions, endowing them with the capacity to regulate a multitude of transcriptional programs. |
| | + | * bHLHs represent key regulatory components in transcriptional networks controlling a number of biological processes. |
| | + | * Plant bHLHs have been reported to function in light signaling, hormone signaling, wound and drought stress responses, symbiotic ammonium transport, shoot branching, root, fruit and flower development, et al. <ref name="ref1" /> <ref name="ref2" /> <ref name="ref3" /> |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | | + | * Similar expression patterns suggest functional conservation between some rice bHLH genes and their close Arabidopsis homologs. |
| − | The level of ''OsPIL1'' mRNA in rice seedlings grown under nonstressed conditions with light/dark cycles oscillated in a circadian manner with peaks in the middle of the light period. Under drought stress conditions, ''OsPIL1'' expression was inhibited during the light period. ''OsPIL1'' was highly expressed in the node portions of the stem using promoter-glucuronidase analysis. Overexpression of ''OsPIL1'' in transgenic rice plants promoted internode elongation. In contrast, transgenic rice plants with a chimeric repressor resulted in short internode sections.
| |
| − | A rice PIF-like gene (''OsPIL1/OsPIL13'', LOC_Os03g56950) was identified by microarray analyses as one of the stress-responsive transcription factor genes that were down-regulated by drought stress. First, we confirmed the stress-responsive expression pattern of the ''OsPIL1'' gene. The level of ''OsPIL1'' mRNA in rice seedlings grown under nonstressed conditions with 12-h light/12-h dark cycles oscillated in a circadianmanner, with peaks in the middle of the light period.
| |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| | + | * The studies of researchers indicate that the ancient bHLH gene family has likely expanded considerably during flowering plant evolution to include many relatively young members, allowing both the conservation and divergence of gene function. |
| | | | |
| − | The molecular mechanisms for the regulation of plant growth and development during stress conditions remains unclear. Our data provide evidence that ''OsPIL1'' functions as a key regulator of reduced plant height in rice during stress conditions. Several results support this conclusion: (i) ''OsPIL1-OXs'' showed activated
| + | You can also add sub-section(s) at will. |
| − | internode elongation via increased cell size, whereas ''OsPIL1-RDs'' had short internode sections resulting from decreased cell size; (ii) ''OsPIL1'' downstream genes included a number of the cell wall-related genes, which have been reported to be involved in plant growth regulation by cell elongation; and (iii) light-dependent expression of ''OsPIL1'' was clearly inhibited during stress conditions.
| |
| − | The set of down-regulated genes in ''OsPIL1-OXs'' included many drought-inducible genes in rice plants. We compared these down-regulated genes with genes downstream of the transcription factors ''OsDREB1A'', ''OsNAC6'', and ''OsbZIP23'', which have been reported to positively regulate expression of stress-responsive genes in rice plants. The number of genes downstream of ''OsDREB1A'', ''OsNAC6'', and ''OsbZIP23'' was 81, 158, and 743, respectively (38–40). Among these genes, only 13,
| |
| − | 37, and 61 genes overlapped with the down-regulated genes in ''OsPIL1-OXs'', respectively. These results suggest that the pathways regulated by OsDREB1A, OsNAC6 and OsbZIP23 act in parallel to the pathway regulated by ''OsPIL1''.
| |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Japan International Research Center for Agricultural Sciences, Tsukuba, Ibaraki 305-8686, Japan;
| + | * Shanghai Jiao Tong University-Shanghai Institutes for Biological Sciences-Pennsylvania State University Joint Center for Life Sciences, Key Laboratory of Microbial Metabolism, Ministry of Education, School of Life Science and Biotechnology, Shanghai Jiao Tong University, Shanghai, People’s Republic of China, 200240 |
| − | | + | * School of Life Science, Shanghai University, Shanghai, People’s Republic of China, 200444 |
| − | Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Tokyo 113-8657, Japan
| + | * School of Life Science, Xiamen University, Xiamen, People’s Republic of China, 361005 |
| − | | + | * Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai, People’s Republic of China, 200032 |
| − | Gene Function Research Center, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305-8562, Japan
| + | * Department of Biology and the Huck Institutes of the Life Sciences, Pennsylvania State University, University Park, Pennsylvania 16802 |
| − | | |
| − | Plant Productivity Systems Research Group and Gene Discovery Research Group, RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan
| |
| | | | |
| | ==References== | | ==References== |
| − | 1. Daisuke Todaka;Kazuo Nakashima;Kyonoshin Maruyama;Satoshi Kidokoro;Yuriko Osakabe;Yusuke Ito;Satoko Matsukura;Yasunari Fujita;Kyouko Yoshiwara;Masaru Ohme-Takagi;Mikiko Kojima;Hitoshi Sakakibara;Kazuo Shinozakie;Kazuko Yamaguchi-Shinozaki.Rice phytochrome-interacting factor-like protein OsPIL1 functions as a key regulator of internode elongation and induces a morphological response to drought stress.Proceedings of the National Academy of Sciences, 2012, 109(39): 15947-15952
| + | <references> |
| − | | + | * <ref name="ref1"> |
| − | 2. Xiao-Ling Zhao;Zhen-Ying Shi;Ling-Tao Peng;Ge-Zhi Shen;Jing-Liu Zhang.An atypical HLH protein OsLF in rice regulates flowering time and interacts with OsPIL13 and OsPIL15.New Biotechnology, 2011, 28(6): 788-797
| + | Li X, Duan X, Jiang H, Sun Y, Tang Y, Yuan Z, Guo J, Liang W, Chen L, Yin J, |
| − | | + | Ma H, Wang J, Zhang D. Genome-wide analysis of basic/helix-loop-helix |
| − | 3. Yuko NAKAMURA;Takahiko KATO;Takafumi YAMASHINO;Masaya MURAKAMI;Takeshi MIZUNO.Characterization of a Set of Phytochrome-Interacting Factor-Like bHLH Proteins in Oryza sativa.Bioscience, Biotechnology, and Biochemistry, 2007, 71(5): 1183-1191
| + | transcription factor family in rice and Arabidopsis. Plant Physiol. 2006 |
| | + | Aug;141(4):1167-84. PubMed PMID: 16896230; PubMed Central PMCID: PMC1533929. |
| | + | </ref> |
| | + | * <ref name="ref2"> |
| | + | Carretero-Paulet L, Galstyan A, Roig-Villanova I, Martínez-García JF, |
| | + | Bilbao-Castro JR, Robertson DL. Genome-wide classification and evolutionary |
| | + | analysis of the bHLH family of transcription factors in Arabidopsis, poplar, |
| | + | rice, moss, and algae. Plant Physiol. 2010 Jul;153(3):1398-412. doi: |
| | + | 10.1104/pp.110.153593. PubMed PMID: 20472752; PubMed Central PMCID: PMC2899937. |
| | + | </ref> |
| | + | * <ref name="ref3"> |
| | + | Feller A, Machemer K, Braun EL, Grotewold E. Evolutionary and comparative |
| | + | analysis of MYB and bHLH plant transcription factors. Plant J. 2011 |
| | + | Apr;66(1):94-116. doi: 10.1111/j.1365-313X.2010.04459.x. Review. PubMed PMID: |
| | + | 21443626. |
| | | | |
| | + | </ref> |
| | + | </references> |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os03g0782500|
| |
| − | Description = Basic helix-loop-helix dimerisation region bHLH domain containing protein|
| |
| − | Version = NM_001058000.1 GI:115455728 GeneID:4334324|
| |
| − | Length = 3289 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os03g0782500, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
| |
| − | AP = Chromosome 3:33283246..33286534|
| |
| − | CDS = 33283985..33284572,33284658..33284759,33284837..33284902,33285084..33285149,33285242..33285529<br>,33285610..33285732|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008396:33283246..33286534
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008396:33283246..33286534
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcgatttgcagcacggacaacgagctggtggagctgctatggcacaacggcggcgtcgtggcgcagccgcaggcggcgcaggcgagggtcgtctcctcctccggccgcggccagagcgccagcgtgctcaccggcgacgacacggagaccgccgcgtggttcccggacaccctcgacgacgcgctggagaaggacctctacacgcagctctggcgcagcgtcaccggcgacgcgttcccggcggccgcggcggcggggccgagctctcaccacgctccgccgccggacttgccgcccccggcggcgaggccgccgatgaggagcggcatcgggtcgagctggaccggcgacatctgttcggccttctgcggcagcaaccacatcccggagacggcggcgcagcgctgccgggacgccggcgcggcattgccgccggagcggccgcgccggtcgagcacccacgacggcgccggcacgtcgtcgtcgggcggctccggcagcaacttcggcgcttccggcttgcccagcgagagcgccagtgcccacaagaggaaaggcagagaagattcagacagtcgcagtgaggatgctgaatgcgaggcaaccgaagagaccaaatcgtcgtcgcggcgatatggatcaaagaggagaactcgtgcagctgaagttcataacctgtcagagaggagaagaagggatcggatcaacgagaagatgcgcgcattgcaagaactcatacctcattgcaacaagaccgacaaggcatctatattagatgaagcaatcgagtatctgaagtcactccaaatgcaagttcagatcatgtggatgactactgggatggcaccaatgatgttccctggtgctcaccagttcatgccaccaatggccgtgggcatgaattctgcgtgcatgcctgcggcacaaggcctaagtcacatgtcaagattgccatacatgaaccattctatgccaaatcacatccctctaaattcatctccagctatgaacccaatgaatgttgcaaaccagatgcagaacattcaactgagagaggcaagcaatcccttccttcacccagatggctggcaaacagtgccaccacaggtatcaggaccatatgcttctgggcctcaagtagcacagcaaaaccagataccgaaagcgtcagctagcactgttctgccaaattctggggctgaacaaccaccaacctctgatggaatttag</cdnaseq>|
| |
| − | AA = <aaseq>MAICSTDNELVELLWHNGGVVAQPQAAQARVVSSSGRGQSASVL TGDDTETAAWFPDTLDDALEKDLYTQLWRSVTGDAFPAAAAAGPSSHHAPPPDLPPPA ARPPMRSGIGSSWTGDICSAFCGSNHIPETAAQRCRDAGAALPPERPRRSSTHDGAGT SSSGGSGSNFGASGLPSESASAHKRKGREDSDSRSEDAECEATEETKSSSRRYGSKRR TRAAEVHNLSERRRRDRINEKMRALQELIPHCNKTDKASILDEAIEYLKSLQMQVQIM WMTTGMAPMMFPGAHQFMPPMAVGMNSACMPAAQGLSHMSRLPYMNHSMPNHIPLNSS PAMNPMNVANQMQNIQLREASNPFLHPDGWQTVPPQVSGPYASGPQVAQQNQIPKASA STVLPNSGAEQPPTSDGI</aaseq>|
| |
| − | DNA = <dnaseqindica>740..1327#1413..1514#1592..1657#1839..1904#1997..2284#2365..2487#gacgcagcccacgggccttgttcccttctcaccacctccaagtacgctttgcgggacactcgcggcagcaagagttcgtatactcgcctctgctgctgctgcactgccgcgcctaaagctgagcaagaagaggagactttgcagcaagagttgctactgtttggtttggttcaggtgagagaggtcaacaatagctgttggcgtggctagttgcttgtgcagaaaaggattctcttttggttttgccctttctgagaagctgatgatgatgtggtggtgggctatggttgtgcaggttggggagctactagaagaaggaggaatagctaggttgggtagctcagctttgctctccttttattttttatttttttttctgtttgttccaaggtttcttgcatcactttgcggcttatcttgttggttttccttctattttaaggtgtaaagtttgtctccttgtcttggttgtgcttgctgttcttgtttgtttcaaccaacttgtgcagttatacttgatgcttaatgcttctttttttttctttttctatgtggtttatgcaggttgtgaatttcttggggggacacaagaatcgtgggatggatggcaatgcgagatcggcggcgaatcagacgaagcaaatcgtgtagagatttcatctgaaacccaagaacggattcgtcttgtgttgttgccgaatggtagtgacctgacctgactctgtgtgcatttgctccaatggcgatttgcagcacggacaacgagctggtggagctgctatggcacaacggcggcgtcgtggcgcagccgcaggcggcgcaggcgagggtcgtctcctcctccggccgcggccagagcgccagcgtgctcaccggcgacgacacggagaccgccgcgtggttcccggacaccctcgacgacgcgctggagaaggacctctacacgcagctctggcgcagcgtcaccggcgacgcgttcccggcggccgcggcggcggggccgagctctcaccacgctccgccgccggacttgccgcccccggcggcgaggccgccgatgaggagcggcatcgggtcgagctggaccggcgacatctgttcggccttctgcggcagcaaccacatcccggagacggcggcgcagcgctgccgggacgccggcgcggcattgccgccggagcggccgcgccggtcgagcacccacgacggcgccggcacgtcgtcgtcgggcggctccggcagcaacttcggcgcttccggcttgcccagcgagagcgccagtgcccacaagaggaaaggcagagaagattcagacagtcgcagtgaggtgatcttttttttttcgttggctgtaacctgcaacttgctatgcttgagatgaattcttgaatgaaactgatgagaaatttcaggatgctgaatgcgaggcaaccgaagagaccaaatcgtcgtcgcggcgatatggatcaaagaggagaactcgtgcagctgaagttcataacctgtcagagagggtgagatcatcaaatacagctactgatcttaagagataaatttttagtagtcatcctaaaagatgatactgatgtagagaagaagggatcggatcaacgagaagatgcgcgcattgcaagaactcatacctcattgcaacaaggtaagaaacattattatatatgcatcttttttctgatcaggtgcaagtccatggactgatacagctatgttggtgagtggtggcatatctgatctatcctttgttgatatgattctcttttttattcaaaccttttgggtttactttactaactgcagttatctatatatttttcaattagaccgacaaggcatctatattagatgaagcaatcgagtatctgaagtcactccaaatgcaagttcaggtttgaactactgtttcttgtatctgaacttacatggtcctacatgaggccaattactagcacagattgagattgtcgaatctgtgcctcagatcatgtggatgactactgggatggcaccaatgatgttccctggtgctcaccagttcatgccaccaatggccgtgggcatgaattctgcgtgcatgcctgcggcacaaggcctaagtcacatgtcaagattgccatacatgaaccattctatgccaaatcacatccctctaaattcatctccagctatgaacccaatgaatgttgcaaaccagatgcagaacattcaactgagagaggcaagcaatcccttccttcacccagatggctggcaaacagtgccaccacaggtacaaaaataccatactgacaaagggaattttcaggcctctttgattgttcacctagattaggcattggtcatttgcaggtatcaggaccatatgcttctgggcctcaagtagcacagcaaaaccagataccgaaagcgtcagctagcactgttctgccaaattctggggctgaacaaccaccaacctctgatggaatttagaatgaccagaaacatgtaagcacttgcaccaatcagtacatctgcctatttacttcaaatgatgttgagataactagagctgcgtatcgctacttgtatgtattactattgttttcagccaatatatctgtattgaacacgatcggcaatttgtgccgtcactttttgtcagcttaagctttcagagcaactaggtaacatgaggacctatggacttacccatatcatctgtagtctgtttgttgagctcgaaatgcatgactagatgcatagaatatgaagccatcatcgtccagcttaaactttcacagtaacctgttagttcatgcaagctaaccagttgttttcatctgacctgtcatatgatggactagtcggtggctccaatctttttggtttttgacatcttctagcactgtccatgaaaattaacggttgtatgtctatttcagcgtcacgctgttgcatcaaatagaccacatgatagcaaagagttgctggtggataacttcagaactattatttatgatcttcattttcttgatattacaggataaggaattcaatgtaggctttgcacaaagggtcgtctttctggagatagctgaaaatattgacatgatgaacagattgcatccatattgctgttatgtatctcaatcagtatctgtctgacataaatgctacaagtgtctgtaaatgcacatagcatttccccccttccctaagatgctaattcccagtgtatgtactaataatccttataatatgaagtgccagtggcaatctttgcccttcttta</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001058000.1 RefSeq:Os03g0782500]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |