Difference between revisions of "Os05g0114400"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os05g0114400| Description = Zinc finger, C2H2-type domain containing protein| Version = NM_001060995.1 GI:115461720 GeneID:4337609| Length = 884...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''Os05g0114400''' was reported as '''''ZOS5-02''''' in 2007 <ref name="ref1" /> by researchers from the India. It is a member of C2H2 transcription factor gene family.
GeneName = Os05g0114400|
 
Description = Zinc finger, C2H2-type domain containing protein|
 
Version = NM_001060995.1 GI:115461720 GeneID:4337609|
 
Length = 884 bp|
 
Definition = Oryza sativa Japonica Group Os05g0114400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
==Annotated Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Gene Symbol===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
*'''''Os05g0114400''''' '''''<=>''''' '''''ZOS5-02'''''
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
 
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
+
* The Cys 2/His 2 zinc-finger proteins (ZFPs) constitute one of the largest transcription factor class regulatory protein families in eukaryotes. <ref name="ref1" /> <ref name="ref2" />
AP = Chromosome 5:761256..762139|
+
* The classical C2H2 zinc finger domain is involved in a wide range of functions and can bind to DNA, RNA and proteins.
CDS = 761432..762028|
+
* Plant Q-type C2H2 zinc finger transcription factors play an important role in plant tolerance to various environmental stresses such as drought, cold, osmotic stress, wounding and mechanical loading.  
GCID = <gbrowseImage1>
+
* The ZFPs not only interact with DNA or chromatin but their interactions with RNA and other proteins are also well documented in lower as well as higher eukaryotes.
name=NC_008398:761256..762139
+
 
source=RiceChromosome05
+
==Labs working on this gene==
preset=GeneLocation
+
* Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi 110021, India
</gbrowseImage1>|
+
* Division of Genetics, Indian Agricultural Research Institute, New Delhi 110012, India
GSID = <gbrowseImage2>
+
* Plant Disease Resistance Research Unit, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba 305-8602 Ibaraki, Japan
name=NC_008398:761256..762139
+
 
source=RiceChromosome05
+
==References==
preset=GeneLocation
+
<references>
</gbrowseImage2>|
+
* <ref name="ref1">
CDNA = <cdnaseq>atgaagaggtttgcattcgaggacagcgatatggcgcgcgtgctgatgctcatgtcgtcgcacgggcagcaggagcaggcgctggctctgccggtgccggtgcagctgccgctcgccgccgcgcgcggcgaccgcgccccggagcgcgcgttcgtctgcaagacgtgcaaccgcgtgttcccgtcgttccaggcgctcggcggccaccgtgccagccacaagaagccgaggctcgacggcgacggcgacctctccctgtccaagcccaagctccacggctgctccatctgcggcctcgagttcgccattggccaggctctcggcggccacatgaggcgccaccgcgccatgaccggcggcatgccgcgggcgatcgtcgtcgacaagaagcccgacgtcgtcgacgtccacgtccacggccacgacgacgacggcggcatcaagcgcggcggcctgtggctcgacctgaaccatccaccctgcgacgacgccggcgacgacgacgccgagtgcggccacaatgccgccggcgccggcatcacgttccaccagttcttggataccggagccatggccgttgactgcgtcggctactag</cdnaseq>|
+
Xu H, Watanabe KA, Zhang L, Shen QJ. WRKY transcription factor genes in wild
AA = <aaseq>MKRFAFEDSDMARVLMLMSSHGQQEQALALPVPVQLPLAAARGD                    RAPERAFVCKTCNRVFPSFQALGGHRASHKKPRLDGDGDLSLSKPKLHGCSICGLEFA                    IGQALGGHMRRHRAMTGGMPRAIVVDKKPDVVDVHVHGHDDDGGIKRGGLWLDLNHPP                    CDDAGDDDAECGHNAAGAGITFHQFLDTGAMAVDCVGY</aaseq>|
+
rice Oryza nivara. DNA Res. 2016 Aug;23(4):311-23. doi: 10.1093/dnares/dsw025.
DNA = <dnaseqindica>112..708#attggagagtcatacatctcaagcttgcttcagatttcgatcagcttcagtcttcagacaacagagaggttggttcacaaagtttcagtaagtaaagcattcattcagatcatgaagaggtttgcattcgaggacagcgatatggcgcgcgtgctgatgctcatgtcgtcgcacgggcagcaggagcaggcgctggctctgccggtgccggtgcagctgccgctcgccgccgcgcgcggcgaccgcgccccggagcgcgcgttcgtctgcaagacgtgcaaccgcgtgttcccgtcgttccaggcgctcggcggccaccgtgccagccacaagaagccgaggctcgacggcgacggcgacctctccctgtccaagcccaagctccacggctgctccatctgcggcctcgagttcgccattggccaggctctcggcggccacatgaggcgccaccgcgccatgaccggcggcatgccgcgggcgatcgtcgtcgacaagaagcccgacgtcgtcgacgtccacgtccacggccacgacgacgacggcggcatcaagcgcggcggcctgtggctcgacctgaaccatccaccctgcgacgacgccggcgacgacgacgccgagtgcggccacaatgccgccggcgccggcatcacgttccaccagttcttggataccggagccatggccgttgactgcgtcggctactagctctctttgccggatttttgccggatactacaatacttatatgcaccgattaatcttggtgcaatttctcttttaccttttctttttcttttcatttcttcttcttcttgttgagaaatccacattttgtagcggtagaatatattagttcctaatacaacagagcatggcacacg</dnaseqindica>|
+
PubMed PMID: 27345721; PubMed Central PMCID: PMC4991837.
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060995.1 RefSeq:Os05g0114400]|
+
</ref>
}}
+
* <ref name="ref2">
[[Category:Genes]]
+
Englbrecht CC, Schoof H, Böhm S. Conservation, diversification and expansion
[[Category:Japonica mRNA]]
+
of C2H2 zinc finger proteins in the Arabidopsis thaliana genome. BMC Genomics.
[[Category:Oryza Sativa Japonica Group]]
+
2004 Jul 5;5(1):39. PubMed PMID: 15236668; PubMed Central PMCID: PMC481060.
[[Category:Japonica Genes]]
+
</ref>
[[Category:Japonica Chromosome 5]]
+
 
[[Category:Chromosome 5]]
+
</references>
 +
 
 +
==Structured Information==
 +
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 5]]

Latest revision as of 01:58, 23 March 2017

The rice Os05g0114400 was reported as ZOS5-02 in 2007 [1] by researchers from the India. It is a member of C2H2 transcription factor gene family.

Annotated Information

Gene Symbol

  • Os05g0114400 <=> ZOS5-02

Function

  • The Cys 2/His 2 zinc-finger proteins (ZFPs) constitute one of the largest transcription factor class regulatory protein families in eukaryotes. [1] [2]
  • The classical C2H2 zinc finger domain is involved in a wide range of functions and can bind to DNA, RNA and proteins.
  • Plant Q-type C2H2 zinc finger transcription factors play an important role in plant tolerance to various environmental stresses such as drought, cold, osmotic stress, wounding and mechanical loading.
  • The ZFPs not only interact with DNA or chromatin but their interactions with RNA and other proteins are also well documented in lower as well as higher eukaryotes.

Labs working on this gene

  • Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi 110021, India
  • Division of Genetics, Indian Agricultural Research Institute, New Delhi 110012, India
  • Plant Disease Resistance Research Unit, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba 305-8602 Ibaraki, Japan

References

  1. 1.0 1.1 Xu H, Watanabe KA, Zhang L, Shen QJ. WRKY transcription factor genes in wild rice Oryza nivara. DNA Res. 2016 Aug;23(4):311-23. doi: 10.1093/dnares/dsw025. PubMed PMID: 27345721; PubMed Central PMCID: PMC4991837.
  2. Englbrecht CC, Schoof H, Böhm S. Conservation, diversification and expansion of C2H2 zinc finger proteins in the Arabidopsis thaliana genome. BMC Genomics. 2004 Jul 5;5(1):39. PubMed PMID: 15236668; PubMed Central PMCID: PMC481060.

Structured Information