Difference between revisions of "Os01g0821600"

From RiceWiki
Jump to: navigation, search
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os01g0821600''''' was reported as '''''OsWRKY21''''' in 2007 <ref name="ref1" /> by researchers from USA.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os01g0821600''''' '''''<=>''''' '''''OsWRKY21'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* The plant '''''WRKY''''' transcription factors are involved in the regulation of various biological processes.
 +
* The  '''''WRKY''''' genes encode zinc-finger proteins, which may play import roles in disease resistance and responses to salicylic acid and jasmonic acid, seed development and germination mediated by gibberellins, other developmental processes including senescence, and responses to abiotic stresses and abscisic acid in rice.
 +
* Several studies have suggested that some '''''WRKY''''' proteins may be the target of mitogen-activated protein kinases (MAPK) that alter their activity.
 +
* The researchers think that the studies of '''''WRKY''''' transcription factors family will not only further our understanding of the fundamental processes that are controlled by WRKY genes in plants, but also help enhance agricultural productivity.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* WRKY mRNA accumulates rapidly after induction and seemingly does not require the synthesis of new transcription factors. <ref name="ref2" />
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* The '''''WRKY''''' gene family is widely distributed among terrestrial plants and is present in both monocotyledonous and dicotyle-donous plants.
 +
* There are more '''''WRKY''''' family members in rice than in Arabidopsis.
 +
* A phylogenetic analysis of WRKY domains between rice and Arabidopsis shows WRKY domains of the same type forming independent domains within their species, suggesting that numerous WRKY gene duplications occurred after the divergence of the monocotyledons from dicotyledons some 50–80 million years ago.<ref name="ref3" />
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Bioinformatics Core, School of Life Sciences, University of Nevada, Las Vegas, Nevada 89154, USA
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Xu H, Watanabe KA, Zhang L, Shen QJ. WRKY transcription factor genes in wild
 +
rice Oryza nivara. DNA Res. 2016 Aug;23(4):311-23. doi: 10.1093/dnares/dsw025.
 +
PubMed PMID: 27345721; PubMed Central PMCID: PMC4991837.
 +
</ref>
 +
* <ref name="ref2">
 +
Eulgem T, Rushton PJ, Robatzek S, Somssich IE. The WRKY superfamily of plant
 +
transcription factors. Trends Plant Sci. 2000 May;5(5):199-206. Review. PubMed
 +
PMID: 10785665.
 +
</ref>
 +
* <ref name="ref3">
 +
Zhang Y, Wang L. The WRKY transcription factor superfamily: its origin in
 +
eukaryotes and expansion in plants. BMC Evol Biol. 2005 Jan 3;5:1. PubMed PMID:
 +
15629062; PubMed Central PMCID: PMC544883.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
GeneName = Os01g0821600|
 
Description = WRKY transcription factor 48-like protein (WRKY transcription factor 21)|
 
Version = NM_001051183.1 GI:115440736 GeneID:4327611|
 
Length = 1735 bp|
 
Definition = Oryza sativa Japonica Group Os01g0821600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:36818585..36820319|
 
CDS = 36818646..36818935,36819150..36819702|
 
GCID = <gbrowseImage1>
 
name=NC_008394:36818585..36820319
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:36818585..36820319
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgatgctggggagctcgtcggcggtggtgctggagctgatgacgatggggtaccagtcggcggcgtacctcggcgagctgctccgggcggcgtccccggcgcaggcaggggatgagcagcaggagctcgccgcggagatcctccgctgctgcgaccgcgtcatcgccaagctgaaccggggaggagccactggtgctactaccggcaagaagcggaaggcggcggagtccgccgccgccgccgccgtgacctccccttctctccccgtcacgccgaccaaaagaagggcgcgtggcgcggaggcggtgagggaggtgaggagcggcacgacgacggacgggttcatctggaggaagtacgggcagaaggagatcaatggctgcaagcacccgaggctctactaccgctgcgcgttcaggggccagggctgcctcgccacgcggcgggtgcagcagtcgcagtcgcaggacgacccggccgcggcgttcgtgatcgcctactacggcgagcacacctgcggaggcgacgccgccgccgccgccgcgtgccgggacggggaactaatgccacctgccgtcatcaactccggcgcgtcgagcttcgccgccgcttggaacatggcctcgcgtgagccggcgtcgtcgctcgccgtcgagcggaggagctgcgacggcgacgctcccagcgagacgtcgcaggggtggtctccctccttctcgtcggaggtggagctggacgtggtgggattcgacctcgccggagccgactcgtcggcgtcgccggtgtgggagttcttgaatggcagcttcgactgggaattcgtcatcaactccctctga</cdnaseq>|
 
AA = <aaseq>MAMLGSSSAVVLELMTMGYQSAAYLGELLRAASPAQAGDEQQEL                    AAEILRCCDRVIAKLNRGGATGATTGKKRKAAESAAAAAVTSPSLPVTPTKRRARGAE                    AVREVRSGTTTDGFIWRKYGQKEINGCKHPRLYYRCAFRGQGCLATRRVQQSQSQDDP                    AAAFVIAYYGEHTCGGDAAAAAACRDGELMPPAVINSGASSFAAAWNMASREPASSLA                    VERRSCDGDAPSETSQGWSPSFSSEVELDVVGFDLAGADSSASPVWEFLNGSFDWEFV                    INSL</aaseq>|
 
DNA = <dnaseqindica>62..351#566..1118#acttcactgcacggcgtcgcggttttcccaagctgagagttgtcgtgcgagagtgaggagcatggcgatgctggggagctcgtcggcggtggtgctggagctgatgacgatggggtaccagtcggcggcgtacctcggcgagctgctccgggcggcgtccccggcgcaggcaggggatgagcagcaggagctcgccgcggagatcctccgctgctgcgaccgcgtcatcgccaagctgaaccggggaggagccactggtgctactaccggcaagaagcggaaggcggcggagtccgccgccgccgccgccgtgacctccccttctctccccgtcacgccgaccaaaagaaggtgaggttccccttattgttttttggcgcggctaccgcgagacatatcgtggtatcaaaaatcgaaaaaaccgtgtggtaaccgtaagatatatcgtggtattaaaaatcgaaaaggttaccgtgcatgataaccgcgataatcgtgtggtaacggtacggttttgtactctatcatgcaaggtagtaacaggtgatttcttggtttggcgcagggcgcgtggcgcggaggcggtgagggaggtgaggagcggcacgacgacggacgggttcatctggaggaagtacgggcagaaggagatcaatggctgcaagcacccgaggctctactaccgctgcgcgttcaggggccagggctgcctcgccacgcggcgggtgcagcagtcgcagtcgcaggacgacccggccgcggcgttcgtgatcgcctactacggcgagcacacctgcggaggcgacgccgccgccgccgccgcgtgccgggacggggaactaatgccacctgccgtcatcaactccggcgcgtcgagcttcgccgccgcttggaacatggcctcgcgtgagccggcgtcgtcgctcgccgtcgagcggaggagctgcgacggcgacgctcccagcgagacgtcgcaggggtggtctccctccttctcgtcggaggtggagctggacgtggtgggattcgacctcgccggagccgactcgtcggcgtcgccggtgtgggagttcttgaatggcagcttcgactgggaattcgtcatcaactccctctgaattttcgatgcttcgtgatcagtagcacaccagctgccccaagagtgcagtagtctttgcaaaacgcacaaaatttcgcgggaactatcgaatttcccgcgtttgcgcttaagttaatagcctcagtagttcgtcagataatcgcacgcactattttaattcaggaagggatttagattgacaaagtatattaggtgagagttaatatgggagaattcgtaatgaagagttgaatgtgttgacgttgacgtacaggggaaaaacacatgctaagaagaaaaatggcaggtgaaaggggcaagaaatggcaaagctgagcaacagagcaggtaataatagagaattgctactcctactacttgcaagcatatatgtccagaagagcagccaaagagaacacaagaccgtcagcttgacgcataactgacgcacttctgatggtaacaaaaaaccggccaccatgtcccatgtgaacgaatggattcattagttgtaataatggtaatagtagtgacactcaattgcaatatcatgcttggtacagggttaaggatcagatggttagtttaaccaccaatagcaacaagctgaaacgaatactggttttgctggatttc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051183.1 RefSeq:Os01g0821600]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 06:36, 23 March 2017

The rice Os01g0821600 was reported as OsWRKY21 in 2007 [1] by researchers from USA.

Annotated Information

Gene Symbol

  • Os01g0821600 <=> OsWRKY21

Function

  • The plant WRKY transcription factors are involved in the regulation of various biological processes.
  • The WRKY genes encode zinc-finger proteins, which may play import roles in disease resistance and responses to salicylic acid and jasmonic acid, seed development and germination mediated by gibberellins, other developmental processes including senescence, and responses to abiotic stresses and abscisic acid in rice.
  • Several studies have suggested that some WRKY proteins may be the target of mitogen-activated protein kinases (MAPK) that alter their activity.
  • The researchers think that the studies of WRKY transcription factors family will not only further our understanding of the fundamental processes that are controlled by WRKY genes in plants, but also help enhance agricultural productivity.

Expression

  • WRKY mRNA accumulates rapidly after induction and seemingly does not require the synthesis of new transcription factors. [2]

Evolution

  • The WRKY gene family is widely distributed among terrestrial plants and is present in both monocotyledonous and dicotyle-donous plants.
  • There are more WRKY family members in rice than in Arabidopsis.
  • A phylogenetic analysis of WRKY domains between rice and Arabidopsis shows WRKY domains of the same type forming independent domains within their species, suggesting that numerous WRKY gene duplications occurred after the divergence of the monocotyledons from dicotyledons some 50–80 million years ago.[3]

You can also add sub-section(s) at will.

Labs working on this gene

  • Bioinformatics Core, School of Life Sciences, University of Nevada, Las Vegas, Nevada 89154, USA

References

  1. Xu H, Watanabe KA, Zhang L, Shen QJ. WRKY transcription factor genes in wild rice Oryza nivara. DNA Res. 2016 Aug;23(4):311-23. doi: 10.1093/dnares/dsw025. PubMed PMID: 27345721; PubMed Central PMCID: PMC4991837.
  2. Eulgem T, Rushton PJ, Robatzek S, Somssich IE. The WRKY superfamily of plant transcription factors. Trends Plant Sci. 2000 May;5(5):199-206. Review. PubMed PMID: 10785665.
  3. Zhang Y, Wang L. The WRKY transcription factor superfamily: its origin in eukaryotes and expansion in plants. BMC Evol Biol. 2005 Jan 3;5:1. PubMed PMID: 15629062; PubMed Central PMCID: PMC544883.

Structured Information