Difference between revisions of "Os11g0685700"

From RiceWiki
Jump to: navigation, search
 
(11 intermediate revisions by 4 users not shown)
Line 1: Line 1:
 +
The rice '''''Os11g0685700''''' was reported as '''''OsWRKY61''''' in 2007 <ref name="ref1" /> by researchers from USA.
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os11g0685700''''' '''''<=>''''' '''''OsWRKY61'''''
  
 
===Function===
 
===Function===
1,Roles in disease resistance and responses to salicylic acid:  The major role of WRKY genes in flowering plants is to mediate defense responses.WRKY18, WRKY40, and WRKY60 form both homocomplexes and heterocomplexes to regulate Arabidopsis responses to the hemibiotrophic bacterial pathogen Pseudomonas syringae and the necrotrophic fungal pathogen Botrytis cinerea.An indica rice WRKY gene, which is identical to OsWRKY12,is induced by the bacterial pathogen Xanthomonas oryzae pv. oryzae.For japonica, an analysis of OsWRKY genes revealed that the expression level of 15 WRKY genes is increased in an interaction between rice and Magnaporthe frisea, a fungal pathogen that causes devastating rice blast disease. Besides,the expression of two OsWRKY genes was increased in SA-treated leaves and that of three OsWRKY genes was increased by jasmonic acid (JA) treatment.
+
* The plant '''''WRKY''''' transcription factors are involved in the regulation of various biological processes.
 +
* The  '''''WRKY''''' genes encode zinc-finger proteins, which may play import roles in disease resistance and responses to salicylic acid and jasmonic acid, seed development and germination mediated by gibberellins, other developmental processes including senescence, and responses to abiotic stresses and abscisic acid in rice.
 +
* Several studies have suggested that some '''''WRKY''''' proteins may be the target of mitogen-activated protein kinases (MAPK) that alter their activity.
 +
* The researchers think that the studies of '''''WRKY''''' transcription factors family will not only further our understanding of the fundamental processes that are controlled by WRKY genes in plants, but also help enhance agricultural productivity.
  
2.Roles in seed development and germination: MINI3 encodes WRKY10, a WRKY class transcription factor, which is responsible for seed growth and development. Besides, two WRKY genes are induced during somatic embryo genesis of orchardgrass. The products of WRKY genes, which named SUSIBA2,is a regulatory transcription factor in starch synthesis. OsWRKY51 and OsWRKY71 are  two ABA-inducible and gibberellin (GA)-repressible rice WRKY genes, which mediate the cross-talk of GA and ABA signaling,can repress the expression of α- amylase gene, as the figure shows. TTG2,a group I WRKY protein is also responsible for trichome development and mucilage production in the seed coat of rice. What's more,WRKY genes is also involved in the process of senescence.Arabidopsis AtWRKY53 is expressed
+
===Expression===
in an age-dependent manner and, when overexpressed, leads to early flowering and senescence.
+
* WRKY mRNA accumulates rapidly after induction and seemingly does not require the synthesis of new transcription factors. <ref name="ref2" />
[[File:tang1.jpg]]
 
  
3,Roles in responses to abiotic stresses and ABA: In the desert plant Retama raetam, a WRKY gene was only induced when the plant was exposed to a combination of heat shock and drought.Several rice WRKY genes to be capable of regulating the ABA-inducible HVA22 promoter in a positive(OsWRKY72 and -77) or negative (OsWRKY24 and -45) manner.A dozen rice WRKY genes are induced by heat shock, cold stress, high salinity, and polyethylene glycol.Hv-WRKY38,the ortholog of OsWRKY51 and -71 ,is upregulated in response to drought and cold in vegetative tissues. Moreover,OsWRKY71 was upregulated by SA,JA, 1-aminocyclo-propane-1-carboxylic acid (ACC), wounding,
+
===Evolution===
and pathogen infection. Overexpression of OsWRKY71 in rice resulted in enhanced resistance to virulent Xoo 13751.
+
* The '''''WRKY''''' gene family is widely distributed among terrestrial plants and is present in both monocotyledonous and dicotyle-donous plants.
 +
* There are more '''''WRKY''''' family members in rice than in Arabidopsis.
 +
* A phylogenetic analysis of WRKY domains between rice and Arabidopsis shows WRKY domains of the same type forming independent domains within their species, suggesting that numerous WRKY gene duplications occurred after the divergence of the monocotyledons from dicotyledons some 50–80 million years ago.<ref name="ref3" />
  
4,Roles in the biosynthesis of secondary metabolites: WRKY genes regulate the biosynthesis of sesquiterpene and benzylisoquinoline alkaloid.CjWRKY1 in C. japonica protoplasts was found to be responsible for the level of transcripts of berberine biosynthetic genes.
+
You can also add sub-section(s) at will.
  
===Evolution===
+
==Labs working on this gene==
 +
* Bioinformatics Core, School of Life Sciences, University of Nevada, Las Vegas, Nevada 89154, USA
  
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Xu H, Watanabe KA, Zhang L, Shen QJ. WRKY transcription factor genes in wild
 +
rice Oryza nivara. DNA Res. 2016 Aug;23(4):311-23. doi: 10.1093/dnares/dsw025.
 +
PubMed PMID: 27345721; PubMed Central PMCID: PMC4991837.
 +
</ref>
 +
* <ref name="ref2">
 +
Eulgem T, Rushton PJ, Robatzek S, Somssich IE. The WRKY superfamily of plant
 +
transcription factors. Trends Plant Sci. 2000 May;5(5):199-206. Review. PubMed
 +
PMID: 10785665.
 +
</ref>
 +
* <ref name="ref3">
 +
Zhang Y, Wang L. The WRKY transcription factor superfamily: its origin in
 +
eukaryotes and expansion in plants. BMC Evol Biol. 2005 Jan 3;5:1. PubMed PMID:
 +
15629062; PubMed Central PMCID: PMC544883.
 +
</ref>
 +
</references>
  
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 11]]
GeneName = Os11g0685700|
 
Description = Oryza sativa (indica cultivar-group) WRKY transcription factor 61 (WRKY61) gene|
 
Version =  GI:46394376|
 
Length = 986 bp|
 
Definition =TPA_inf: Oryza sativa (indica cultivar-group) WRKY transcription factor 61 (WRKY61) gene, complete cds.|
 
Source = Oryza sativa Indica Group (long-grained rice)
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.|
 
CDS = 1..113,284..574,674..986|
 
CDNA = <cdnaseq>  1 atggaaagaa ggaaggtgat caggatgagt tatacagagg atgacggctt cagctggagg
 
      61 aagtacgggc agaaggacgt ggaaggcgcc atgcacccaa ctacccaaag taa
 
      241                                          aagttat ttccgatgtg
 
      301 cccacaagat gacgacgggc tgtaaggcac ggaagaaggt gcagcgcacc gacggcgacc
 
      361 cgctgatggt cgacgtcgta tacaaggggg ttcacagctg tgccggcgtg cattccgaca
 
      421 gccagagatc atccgccgcg agctctaagt ctaacctgcg gccgacgaag agcatgcagg
 
      481 tgagggcgag ctccaaggac gtcggccccc cagacgacgg ttacagctgg aagaggtacg
 
      541 gccagaagaa catcttcggc gctaattacc caag
 
      661            atgctac taccggtgta tacacaagac cacgacgggc tgcactgcga
 
      721 caaaaaatgc acaggccacc gatggtgacc cactcctctt cgacgtcgtg taccacgggg
 
      781 agcacacctg cgatctgcag agcacgcact ccaacgacgt cgaaccgatc aggccgcagt
 
      841 ctgggctcga cgacgacatg tgtaccgacg atacgacgac tgtctccaca cgccacgaca
 
      901 gcaacacgga tgcgtcctca attagttttc aattagattg gaccaattgc aaagacgaat
 
      961 cggatggccc tcccaccacc ctataa
 
</cdnaseq>|
 
AA = <aaseq>MERRKVIRMSYTEDDGFSWRKYGQKDVEGAMHPTTQSKSYFRCA
 
 
 
HKMTTGCKARKKVQRTDGDPLMVDVVYKGVHSCAGVHSDSQRSSAASSKSNLRPTKSM
 
 
 
QVRASSKDVGPPDDGYSWKRYGQKNIFGANYPRCYYRCIHKTTTGCTATKNAQATDGD
 
 
 
PLLFDVVYHGEHTCDLQSTHSNDVEPIRPQSGLDDDMCTDDTTTVSTRHDSNTDASSI
 
 
 
SFQLDWTNCKDESDGPPTTL</aaseq>|
 
DNA = <dnaseqindica>
 
        1 atggaaagaa ggaaggtgat caggatgagt tatacagagg atgacggctt cagctggagg
 
      61 aagtacgggc agaaggacgt ggaaggcgcc atgcacccaa ctacccaaag taagtaagcg
 
      121 atgacgactc gtgccaatta acttaaagtt aaattaaggt tgattgattt aatgaagcat
 
      181 cgaatgcatg caaagagctt aattaattaa gagcagagcg gaataatctg attaacccga
 
      241 tcttgttcaa cttataactg tcgtcggaac tctactcttg tagaagttat ttccgatgtg
 
      301 cccacaagat gacgacgggc tgtaaggcac ggaagaaggt gcagcgcacc gacggcgacc
 
      361 cgctgatggt cgacgtcgta tacaaggggg ttcacagctg tgccggcgtg cattccgaca
 
      421 gccagagatc atccgccgcg agctctaagt ctaacctgcg gccgacgaag agcatgcagg
 
      481 tgagggcgag ctccaaggac gtcggccccc cagacgacgg ttacagctgg aagaggtacg
 
      541 gccagaagaa catcttcggc gctaattacc caaggttagt ggctgattaa cgtacgactg
 
      601 tacctgaaat gaactggcac tgctgctgga gtacatgaaa tcgaactgat ctcgctcgcc
 
      661 atctattttg cagatgctac taccggtgta tacacaagac cacgacgggc tgcactgcga
 
      721 caaaaaatgc acaggccacc gatggtgacc cactcctctt cgacgtcgtg taccacgggg
 
      781 agcacacctg cgatctgcag agcacgcact ccaacgacgt cgaaccgatc aggccgcagt
 
      841 ctgggctcga cgacgacatg tgtaccgacg atacgacgac tgtctccaca cgccacgaca
 
      901 gcaacacgga tgcgtcctca attagttttc aattagattg gaccaattgc aaagacgaat
 
      961 cggatggccc tcccaccacc ctataa</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/46394375]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 

Latest revision as of 07:14, 23 March 2017

The rice Os11g0685700 was reported as OsWRKY61 in 2007 [1] by researchers from USA.

Annotated Information

Gene Symbol

  • Os11g0685700 <=> OsWRKY61

Function

  • The plant WRKY transcription factors are involved in the regulation of various biological processes.
  • The WRKY genes encode zinc-finger proteins, which may play import roles in disease resistance and responses to salicylic acid and jasmonic acid, seed development and germination mediated by gibberellins, other developmental processes including senescence, and responses to abiotic stresses and abscisic acid in rice.
  • Several studies have suggested that some WRKY proteins may be the target of mitogen-activated protein kinases (MAPK) that alter their activity.
  • The researchers think that the studies of WRKY transcription factors family will not only further our understanding of the fundamental processes that are controlled by WRKY genes in plants, but also help enhance agricultural productivity.

Expression

  • WRKY mRNA accumulates rapidly after induction and seemingly does not require the synthesis of new transcription factors. [2]

Evolution

  • The WRKY gene family is widely distributed among terrestrial plants and is present in both monocotyledonous and dicotyle-donous plants.
  • There are more WRKY family members in rice than in Arabidopsis.
  • A phylogenetic analysis of WRKY domains between rice and Arabidopsis shows WRKY domains of the same type forming independent domains within their species, suggesting that numerous WRKY gene duplications occurred after the divergence of the monocotyledons from dicotyledons some 50–80 million years ago.[3]

You can also add sub-section(s) at will.

Labs working on this gene

  • Bioinformatics Core, School of Life Sciences, University of Nevada, Las Vegas, Nevada 89154, USA

References

  1. Xu H, Watanabe KA, Zhang L, Shen QJ. WRKY transcription factor genes in wild rice Oryza nivara. DNA Res. 2016 Aug;23(4):311-23. doi: 10.1093/dnares/dsw025. PubMed PMID: 27345721; PubMed Central PMCID: PMC4991837.
  2. Eulgem T, Rushton PJ, Robatzek S, Somssich IE. The WRKY superfamily of plant transcription factors. Trends Plant Sci. 2000 May;5(5):199-206. Review. PubMed PMID: 10785665.
  3. Zhang Y, Wang L. The WRKY transcription factor superfamily: its origin in eukaryotes and expansion in plants. BMC Evol Biol. 2005 Jan 3;5:1. PubMed PMID: 15629062; PubMed Central PMCID: PMC544883.


Structured Information