Difference between revisions of "Os09g0522100"

From RiceWiki
Jump to: navigation, search
(References)
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os09g0522100''''' was reported as '''''OsERF#133''''' in 2006 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os09g0522100''''' '''''<=>''''' '''''OsERF#133'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
    The alignment of amino acids showed that V14 was also conserved in these rice CBF/DREB1 proteins. However, the E19 is substituted by valine in a few rice CBF/DREB1 proteins. Similar to the structure of Arabidopsis  CBF/DREB1genes, three rice genes (Os09g0522000, Os09g0522100 and Os09g0522200) designed as OsCBF1, OsCBF2and OsCBF3, respectively, are organized in tandem on chromosome 9, indicating that they might play similar functions as Arabidops is CBF/DREB1genes in cold acclimation.
+
* It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
1.Cold acclimation increased cold tolerance of rice seedlings
+
* Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).<ref name="ref2" />
    Plants from temperate regions can increase their freezing tolerance after cold acclimation. However, rice seedlings can not survive at freezing temperature and exhibit growth retardation at the temperature below 12 °C. To check whether rice can be acclimated to cold stress, we pretreated 3-leaf seedlings at 10 °C for 1 d to mimic cold acclimation, and then evaluated the cold tolerance of rice seedlings at 5 °C. Without cold acclimation, the survival rates of Nipponbare and 93-11 were about 50% after 5 °C treatment for 7 d and 3 d, respectively (Fig. 2). Pretreatment at 10 °C increased cold tolerance of rice seedlings significantly. The survival rate of Nipponbare seedlings after cold acclimation was 88.4%, while that of control plants was 50.9%. Similarly, the survival rate of 93-11 after cold acclimation was 90.9%, while that of control was 52.5%. The increase of survival rate due to cold acclimation was 37.5 percent point in Nipponbare and 38.4 percent point in 93-11, respectively. These results suggest that 10 °C cold acclimation can enhance the cold tolerance of Nipponbare and 93-11 seedlings.
 
2.Cold acclimation decrease electrolyte leakage under cold stress
 
    The electrolyte leakage (EL) of leaves is an effective physiological index to evaluate cold-induced membrane injury (Yu et al, 2006). In order to elucidate the mechanism of increased cold tolerance due to cold acclimation, we examined the time-course EL after exposure to chilling stress at 5 °C. As shown in Fig. 3-A, both Nipponbare and 93-11 maintained a low-level EL under normal growth conditions. The EL of acclimated 93-11 was higher than that of unacclimated 93-11 before chilling stress, implying that cold acclimation caused damage to 93-11. After the chilling treatment, the EL of Nipponbare without cold acclimation increased from 6 h and then decreased from 12 h. However, the EL of Nipponbare after cold acclimation did not increase significantly after the treatment. Correspondingly, the EL of 93-11 without cold acclimation increased rapidly after the treatment, while the EL of 93-11 after cold acclimation decreased during 6–24 h and displayed lower than that without cold acclimation. These results suggested that cold acclimation decreased the EL of both Nipponbare and 93-11 under chilling stress. To evaluate the influence of cold acclimation, we compared the time-course amplitude of EL between the two rice varieties.  As shown in Fig. 3-B, the amplitude of leaf EL was subzero before treatment for 6 h, indicating that the process of cold acclimation resulted in the damage to seedlings. The damage was more serious in 93-11, implying that 93-11 was much more sensitive to cold stress than Nipponbare. However, the amplitude of leaf EL in 93-11 increased rapidly and was higher than that inNipponbare after 24 h- treatment. These results suggest that 93-11 might have better ability to acclimate to cold stress.
 
 
 
===Expression===
 
Please input expression information here.
 
CBF cold response pathway has proven to play critical roles in cold acclimation in many subspecies (Jaglo et al, 2001). In order to know the molecular basis of rice cold acclimation, we examined the expression of CBF/DREB1genes in the process of cold acclimation at 10 °C. As shown in Fig. 4, the three CBF/DREB1genes (OsCBF1,  OsCBF2and OsCBF3) exhibited similar expression profiles during cold acclimation in Nipponbare and 93-11. The transcriptions increased at 1 h and subsequently reached their peaks at 2 h and then decreased. Interestingly, the gene induction was much stronger in 93-11 than in Nipponbare. The CBF proteins can bind to the CRT/DRE regulatory element and activate the expression of downstream target genes (Wang and Hua, 2009). Therefore, we further analyzed the expression of several candidate down- stream genes. Cold-induced genes OsLIP5and OsLIP9 showed no obvious changes in Nipponbare during cold acclimation. Differently, the expression of these two genes was induced after acclimation for 2 h and then decreased in 93-11. Another candidate target gene OsP5CS, encoding a central enzyme in the proline biosynthesis, exhibited induction both in Nipponbare and 93-11. However, the induction was stronger in 93-11 than in Nipponbare. Based on these results, we proposed that differential induction of CBF/DREB1 genes during cold acclimation might result in differential expression of downstream genes and was responsible for significant EL decrease in 93-11 compared to that in Nipponbare.
 
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
There were many InDels and SNPs within the promoters of CBF/DREB1genes in Nipponbare and 93-11. cis-element analysis implied that a few MYC motifs were absent in Nipponbare but present in 93-11 due to SNPs ([[File: evolution.png‎‎|left|thumb|150px|Table : cis-element analysis of promoter sequences of CBF/DREB1 genes in Nipponbare and 93-11.]]). It is speculated that more MYC motifs in 93-11 might contribute to stronger induction of CBF/DREB1genes as compared with Nipponbare. 
+
* The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
 +
* The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
 +
* The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
 +
* Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.<ref name="ref3" />
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
 +
* Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)
 +
 
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
1.Yu X, Peng Y H, Zhang M H, Shao Y J, Su W A, Tang Z C. 2006. Water relations and an expression analysis of plasma membrane intrinsic proteins in sensitive and tole
+
* <ref name="ref1">
2.Wang Y, Hua J. 2009. A moderate decrease in temperature induces COR15aexpression through the CBF signaling cascade and enhances freezing tolerance. Plant J, 60: 340–349.
+
Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF
3.Jaglo K R, Kleff S, Amundsen K L, Zhang X, Haake V, Zhang J Z, Deits T, Thomashow M F. 2001. Components of the Arabidopsis C-repeat/dehydration-responsive element    binding factor cold-response pathway are conserved in Brassica napusand other plant species. Plant Physiol, 127: 910–917.
+
gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32.
4.PANXiao-wu, L., Xiao-xiang, L., Wen-qiang, L., MINJun, L.-t., and SHENGXin-nian, T. (2012). Differential Regulatory Mechanism of CBF Regulon Between Nipponbare (japonica) and 93-11 (indica) During Cold Acclimation. Chinese Journal of Rice Science 5, 001.
+
PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
 +
</ref>
 +
* <ref name="ref2">
 +
Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet
 +
meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov
 +
8;298(5596):1238-41. PubMed PMID: 12424380.
 +
</ref>
 +
* <ref name="ref3">
 +
Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription
 +
factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os09g0522100|
 
Description = Similar to C-repeat binding factor 3-like protein|
 
Version = NM_001070246.1 GI:115480234 GeneID:4347619|
 
Length = 741 bp|
 
Definition = Oryza sativa Japonica Group Os09g0522100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:21142100..21142840|
 
CDS = 21142100..21142840|
 
GCID = <gbrowseImage1>
 
name=NC_008402:21142100..21142840
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:21142100..21142840
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggacatggccggccacgaggtgaactccagctcgtcgtcgtcgggggcggagtcgtcgtcgtcctcgtcggggcggcagcagtacaagaagcggcccgcggggcgcaccaagttcagggagacgcggcacccggtgtaccgcggcgtgcggcgccgcggcggggcggggcggtgggtgtgcgaggtgcgcgtcccggggaagcgcggcgcgcgcctgtggctcggcacgtacgtcaccgccgaggccgcggcgcgcgcgcacgacgccgccatgatcgcgctccgcggcggcgccggcggaggcggcgcggcgtgcctcaacttccaggactccgcgtggctgctcgccgtcccgcccgccgcgccgtccgacctggccggcgtccgccgcgcggccaccgaggccgtcgcgggcttcctccagcgcaacaagaccacgaacggcgcctccgtcgcggaggccatggacgaggccacctccggcgtgtccgcgccgccgccgctggccaacaatgccggctcgtcggagacgcccggaccttcatcgatcgacggaacggctgacacggcggcgggggcggcgctggacatgttcgagctcgacttcttcggcgaaatggactacgacacgtactacgcgagcctggccgaggggcttctcatggagccgccgccggcggcgaccgcactctgggacaacggcgacgaaggcgctgacatcgcgctctggagctactga</cdnaseq>|
 
AA = <aaseq>MDMAGHEVNSSSSSSGAESSSSSSGRQQYKKRPAGRTKFRETRH                    PVYRGVRRRGGAGRWVCEVRVPGKRGARLWLGTYVTAEAAARAHDAAMIALRGGAGGG                    GAACLNFQDSAWLLAVPPAAPSDLAGVRRAATEAVAGFLQRNKTTNGASVAEAMDEAT                    SGVSAPPPLANNAGSSETPGPSSIDGTADTAAGAALDMFELDFFGEMDYDTYYASLAE                    GLLMEPPPAATALWDNGDEGADIALWSY</aaseq>|
 
DNA = <dnaseqindica>1..741#atggacatggccggccacgaggtgaactccagctcgtcgtcgtcgggggcggagtcgtcgtcgtcctcgtcggggcggcagcagtacaagaagcggcccgcggggcgcaccaagttcagggagacgcggcacccggtgtaccgcggcgtgcggcgccgcggcggggcggggcggtgggtgtgcgaggtgcgcgtcccggggaagcgcggcgcgcgcctgtggctcggcacgtacgtcaccgccgaggccgcggcgcgcgcgcacgacgccgccatgatcgcgctccgcggcggcgccggcggaggcggcgcggcgtgcctcaacttccaggactccgcgtggctgctcgccgtcccgcccgccgcgccgtccgacctggccggcgtccgccgcgcggccaccgaggccgtcgcgggcttcctccagcgcaacaagaccacgaacggcgcctccgtcgcggaggccatggacgaggccacctccggcgtgtccgcgccgccgccgctggccaacaatgccggctcgtcggagacgcccggaccttcatcgatcgacggaacggctgacacggcggcgggggcggcgctggacatgttcgagctcgacttcttcggcgaaatggactacgacacgtactacgcgagcctggccgaggggcttctcatggagccgccgccggcggcgaccgcactctgggacaacggcgacgaaggcgctgacatcgcgctctggagctactga</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070246.1 RefSeq:Os09g0522100]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 07:40, 23 March 2017

The rice Os09g0522100 was reported as OsERF#133 in 2006 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os09g0522100 <=> OsERF#133

Function

  • Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
  • It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
  • Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).[2]

Evolution

  • The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
  • The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
  • The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
  • The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
  • Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.[3]

You can also add sub-section(s) at will.

Labs working on this gene

  • Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
  • Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)


References

  1. Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32. PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
  2. Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov 8;298(5596):1238-41. PubMed PMID: 12424380.
  3. Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.

Structured Information