Difference between revisions of "Os02g0656600"

From RiceWiki
Jump to: navigation, search
(Mutations)
(References)
 
(7 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os02g0656600''''' was reported as '''''OsERF#032''''' in 2006 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os02g0656600''''' '''''<=>''''' '''''OsERF#032'''''
 +
 
===Function===
 
===Function===
GPA3 encodes a plant-specific kelch-repeat protein that is localized to
+
* Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
the trans-Golgi networks, DVs, and PSVs in the developing endosperm. In vitro and in vivo experiments verified that GPA3 directly interacts with the rice Rab5a-guanine exchange factor VPS9a and forms a regulatory complex with Rab5a via VPS9a.GPA3 acts synergistically with Rab5a and VPS9a to regulate DV-mediated post-Golgi traffic in rice<ref name="ref1" />.
+
* It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
 
+
* Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).<ref name="ref2" />
===Mutations===
 
*Phenotypic Characterization of the gpa3 Mutant
 
The gpa3 plants exhibited no visible abnormalities before the grainfilling
 
stage, such as plant height, tiller number, and heading date.After fertilization, the gpa3 mutant exhibited a markedly slower grain-filling rate (Figure 1A) and eventually produced a shrunken and floury endosperm (Figure 1B),Scanning electron microscopy analysis revealed that the wild-type endosperm was filled with densely packed, polyhedral starch granules, but endosperm of the gpa3 mutant was packed with round, irregularly arranged compound starch granules (Figure 1C)<ref name="ref1" />.SDS-PAGE and immunoblot analyses revealed that the accumulation of prolamins was comparable in the dry seeds of the wild type and the gpa3 mutant. However, the gpa3 mutant seeds exhibited increased accumulation of 57-kD proglutelins, accompanied by reduced accumulation of the mature acidic and basic subunits as well as a-globulins, compared with wild-type seeds
 
(Figures 1D and 1E),In addition, immunoblot analysis using isoform specific antibodies revealed increased accumulation of proglutelins for all glutelin subfamilies(GluA, GluB, and GluC; Takemoto et al., 2002), accompanied by decreased accumulation of their respective acidic subunits in the gpa3 mutant (Figure 1F), suggesting that a defect in a regulatory
 
factor rather than glutelin structural genes may be responsible for the gpa3 mutant phenotypes(Figure 1)<ref name="ref1" />.
 
[[File:Figure 1.png|right|thumb|320px|'''Figure 1.''' ''Phenotypic Analyses of the gpa3 Mutant.<ref name="ref1" />'']]
 
*Abnormal Deposition of Glutelins and a-Globulins in the gpa3 Mutant
 
As shown in Figures 2A and 2B, Coomassie blue staining showed that the storage proteins were most abundant in the subaleurone layer of endosperm in both the wild type and the gpa3 mutant.numerous glutelin- and a-globulin–containing protein granules distributed near the cell periphery in the gpa3 mutant endosperm but not in wild-type endosperm (Figures 2C to 2F)(Figure 2)<ref name="ref1" />.
 
[[File:the Wild Type and the gpa3 Mutant.png|right|thumb|320px|'''Figure2.''' ''Light and Immunofluorescence Microscopy Images of Protein Bodies in the Subaleurone Cells of the Wild Type and the gpa3 Mutant.<ref name="ref1" />'']]
 
 
 
===Expression===
 
the phenotypes of the gpa3 mutant were restricted to endosperm, GPA3 expression was detected in all tissues examined, including root, stem,
 
leaf, leaf sheath, panicle, and endosperm, with highest accumulation
 
in the leaf(Figure 3G).During endosperm development,the expression of GPA3 was low at an early stage, then peaked at;18 DAF, and slowly decreased after 21 DAF (Figure 3H).Thus,GPA3 encodes a plant-specific kelch-repeat
 
protein and that it is broadly expressed inmultiple organs and tissues.
 
[[File:the expression of GPA3.png|right|thumb|320px|'''Figure3.''' ''Expression Analysis of GPA3.<ref name="ref1" />'']]
 
  
 
===Evolution===
 
===Evolution===
Please input evolution information here
+
* The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
 +
* The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
 +
* The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
 +
* The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
 +
* Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.<ref name="ref3" />
  
 +
You can also add sub-section(s) at will.
  
 +
==Labs working on this gene==
 +
* Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
 +
* Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)
  
 
 
===Localization===
 
To determine the subcellular localization of the GPA3 protein,P35S:GPA3-GFP was transiently expressedin Arabidopsis protoplasts.As expected, GFP itself was distributed evenly in the cytoplasm and the nucleus, whereas the GPA3-GFP fusion protein was mainly localized to the cytoplasm and to punctate compartments in the cytosol. Moreover,we observed colocalization of various combinations of GPA3 fused with either fluorescent protein (GFP or mCherry) or a Flag tag at the N terminus or C terminus in Arabidopsis protoplasts.To determine the nature of these punctate compartments, we coexpressed GPA3-GFP and fluorescent marker proteins characteristic for the Golgi apparatus , the TGN and the PVC . As shown in Figures 4A to 4C, the punctate compartments of GPA3-GFP were obviously distinct from the Golgi but partially overlapped with the TGN and PVC. Furthermore, correlation analysis using the Pearson-Spearman correlation (PSC) plugin for ImageJ revealed strong correlation between GPA3-GFP and the PVC marker , but the correlation between GPA3-GFP and the TGN marker appeared to be weaker.Furthermore, immunoelectron microscopy analysis with anti-GFP antibodies revealed that GPA3-GFP was targeted to the TGN, DVs, and PBIIs (Figure 4D). Together, these data indicated that GPA3 is localized to various post-Golgi compartments irrespective of the cell types(Figure 4).
 
[[File:Subcellular Localization of GPA3 in Arabidopsis Protoplasts and Developing Subaleurone Cells.png|right|thumb|320px|'''Figure 4.''' ''Figure 4. Subcellular Localization of GPA3 in Arabidopsis Protoplasts and Developing Subaleurone Cells.<ref name="ref1" />'']]
 
 
==Labs working on this gene==
 
*State Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University, Nanjing 210095, China
 
*National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing 100081, China
 
*School of Life Sciences, Centre for Cell and Developmental Biology, Chinese University of Hong Kong, New Territories, Hong Kong 999077, China
 
*College of Life Sciences, Nanjing Agricultural University, Nanjing 210095, China
 
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 
+
* <ref name="ref1">
==Structured Information==
+
Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF
{{JaponicaGene|
+
gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32.
GeneName = Os02g0656600|
+
PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
Description = Similar to Dehydration responsive element binding protein 2B (DREB2B protein)|
+
</ref>
Version = NM_001054162.1 GI:115447694 GeneID:4330202|
+
* <ref name="ref2">
Length = 1080 bp|
+
Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet
Definition = Oryza sativa Japonica Group Os02g0656600, complete gene.|
+
meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov
Source = Oryza sativa Japonica Group
+
8;298(5596):1238-41. PubMed PMID: 12424380.
 +
</ref>
 +
* <ref name="ref3">
 +
Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription
 +
factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.
 +
</ref>
 +
</references>
  
  ORGANISM  Oryza sativa Japonica Group
+
<br>
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:27411434..27412513|
 
CDS = 27411524..27412387|
 
GCID = <gbrowseImage1>
 
name=NC_008395:27411434..27412513
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:27411434..27412513
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggaagctgccgcgatccatgcgcccaccaccaccacctcctccgactccggctcgtgcgtcaccaatggcacgcgagagaagcgcgagatctctaagcacaagcagctcaagcggaagaggagcacctctcctgctcctcctcccggctgcggcggcggccaaggacaggaagcggcggtggagactgacgctgacgctggcgccgccggcgaggaggagagcagcagctgcggtggcgctggcgccggcgagggcgagcgcaagaggggtgacgccggcaggcacccgtcgtaccgcggcgtgaggcggcggagctggggcaagtgggtgtcggagatccgcgagccgcgcaagaagtcgcgcatctggctcggcaccttcccgacggcggagatggccgcgcgcgcgcacgacgtggccgcgctcgccatcaagggccgcgccgcgcacctcaacttcccgagcctcgcccacacgctcccgcgcccggcctccacctcaccctccgacatccaggccgccgccgccctcgccgcagctgcagccgccaccgaccaatgcgagtcctcctcctctgccgtcgccgccgccaccgccaccgacgccgaggcggcggagtccacctcgtcggccgcggccagcccgtgcgccgccaccagcagcgtcgaggagaacgcgctgttcgacctgcccgaccttctcctcgacctgagcgacgggctctggtgctcacccgtctggacgacagcgccggccgatcagtacgacgccggcgacgacggcgacgacgccgcggcgccgctcctgtgggccgagcagtgctggatggacgccccagcggcgcccgtgcagcctgactaa</cdnaseq>|
 
AA = <aaseq>MEAAAIHAPTTTTSSDSGSCVTNGTREKREISKHKQLKRKRSTS                    PAPPPGCGGGQGQEAAVETDADAGAAGEEESSSCGGAGAGEGERKRGDAGRHPSYRGV                    RRRSWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIKGRAAHLNFPSLAHT                    LPRPASTSPSDIQAAAALAAAAAATDQCESSSSAVAAATATDAEAAESTSSAAASPCA                    ATSSVEENALFDLPDLLLDLSDGLWCSPVWTTAPADQYDAGDDGDDAAAPLLWAEQCW                    MDAPAAPVQPD</aaseq>|
 
DNA = <dnaseqindica>91..954#cctggaaggaagcgcatctccttcctgcggtattctgtgtgcctctctctctctctctctcctccaccttgtcgtagagaggaggcggccatggaagctgccgcgatccatgcgcccaccaccaccacctcctccgactccggctcgtgcgtcaccaatggcacgcgagagaagcgcgagatctctaagcacaagcagctcaagcggaagaggagcacctctcctgctcctcctcccggctgcggcggcggccaaggacaggaagcggcggtggagactgacgctgacgctggcgccgccggcgaggaggagagcagcagctgcggtggcgctggcgccggcgagggcgagcgcaagaggggtgacgccggcaggcacccgtcgtaccgcggcgtgaggcggcggagctggggcaagtgggtgtcggagatccgcgagccgcgcaagaagtcgcgcatctggctcggcaccttcccgacggcggagatggccgcgcgcgcgcacgacgtggccgcgctcgccatcaagggccgcgccgcgcacctcaacttcccgagcctcgcccacacgctcccgcgcccggcctccacctcaccctccgacatccaggccgccgccgccctcgccgcagctgcagccgccaccgaccaatgcgagtcctcctcctctgccgtcgccgccgccaccgccaccgacgccgaggcggcggagtccacctcgtcggccgcggccagcccgtgcgccgccaccagcagcgtcgaggagaacgcgctgttcgacctgcccgaccttctcctcgacctgagcgacgggctctggtgctcacccgtctggacgacagcgccggccgatcagtacgacgccggcgacgacggcgacgacgccgcggcgccgctcctgtgggccgagcagtgctggatggacgccccagcggcgcccgtgcagcctgactaattaagccaatccacctgctccgactcgccggccggccattgcaccggttgggttggtcgcagcagtcaacctatcgacaccatgggcgtctttttcttttctctctgtttttttttcttttttgga</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054162.1 RefSeq:Os02g0656600]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 07:41, 23 March 2017

The rice Os02g0656600 was reported as OsERF#032 in 2006 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os02g0656600 <=> OsERF#032

Function

  • Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
  • It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
  • Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).[2]

Evolution

  • The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
  • The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
  • The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
  • The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
  • Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.[3]

You can also add sub-section(s) at will.

Labs working on this gene

  • Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
  • Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)


References

  1. Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32. PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
  2. Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov 8;298(5596):1238-41. PubMed PMID: 12424380.
  3. Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.