Difference between revisions of "Os06g0604000"

From RiceWiki
Jump to: navigation, search
(Expression)
 
(4 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os06g0604000''''' was reported as '''''OsERF#001''''' in 2006 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os06g0604000''''' '''''<=>''''' '''''OsERF#001'''''
  
The ethylene response factor (ERF) gene WIN1/SHN1 was shown to transcriptionally activate the expression of wax synthesis genes and wax production, resulting in drought tolerance in Arabidopsis. To further investigate the regulation of ERF proteins in rice, we started with homology search for rice genes in the National Center of Biological Informatics using the Arabidopsis WIN1/SHN1 as a probe and found 4 rice orthologues with high amino acid identities in N-terminal region. These rice WIN1-like genes, named rice wax synthesis regulator (OsWR), all encode ERF proteins that contain a basic N-terminal region that might function as an nuclear localization signal and an acidic C-terminal region that might act as an activation domain for transcription. OsWR2 (Os06g0604000) is one of them.
 
 
===Function===
 
===Function===
 
+
* Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
The Wax Synthesis Regulatory 2 gene (OsWR2) in rice (Oryza sativa L.) is highly expressed in epidermal tissues and contributes to the transcriptional regulation of both cuticular wax and cutin biosynthesis in rice cuticle. Overexpression of OsWR2 in rice increased the total cuticular wax level by 48.6%in leaves and by 72.4% in panicles. Of the major wax classes, aldehydes increased most in leaves, and alkanes increased most in panicles. Total cutin amounts were increased by 48.1 % in leaves and 65.9 % in panicles of rice overexpressing OsWR2, and these increases were due primarily to the increase inω-OH and di-OH acids. Our results showed that 19 genes previously associated with wax and cutin biosynthesis were up-regulated in OsWR2 overexpressors.
+
* It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
Overexpression of OsWR2 also altered cuticular wax crystallization and cuticlemembrane ultrastructure. Furthermore, OsWR2 overexpression in rice decreased leaf chlorophyll leaching rate, reduced water loss rate, and enhanced tolerance to water-limited conditions. We demonstrate in this report that OsWR2 regulates wax and cutin biosynthesis differently than does the OsWR1 homologue, and plays a major role in controlling cuticle permeability. The increased resistance to water deficit conditions by OsWR2 overexpression in rice elucidates a potential new strategy for genetic improvement of plant drought tolerance.
+
* Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).<ref name="ref2" />
 
 
===Expression===
 
 
 
[[File:Fig-1.jpg|right|thumb|150px|''Fig-1 OsWR2 expression profile in different organs of wild type (WT) Nipponbare and under different stresses. a: Semiquantitative RT-PCR analysis of OsWR2 expression profile in different organs of Nipponbare. R Root, C culm, L leaf, Sh sheath, P panicle, S seed, Sl seedling. OsActin1 gene was used as a control. b: Histochemical staining of GUS activity in pOsWR2::GUS transgenic rice plants. Bars: Root 80 μm; sheath, leaf blade 10 μm; culm, stamen 0.5 mm; anther 80 μm; glume, seed 2mm; lemma 1 μm. c: Semiquantitative RT-PCR analysis of OsWR2 expression profile in different stress treated Leaves. NT, Untreated Nipponbare. OsActin1 gene was used as a control'']]
 
RT-PCRanalysis of the OsWR2 expression in different organs of WT Nipponbare showed that OsWR2 expression was high in culm, leaf blade, leaf sheath, panicle and seedling, but low in root and very low in seed (Fig. 1a). Further OsWR2 expression analysis using the pOsWR2:GUS reporter construction revealed ubiquitous expression of OsWR2 in the epidermis of aerial parts of transgenic rice (Fig. 1b). In roots, GUS activity was detectedmainly in the exodermal and endodermal cells, whereas no expression was detected in cortical cell and vascular cylinder. In leaf sheath and blade, OsWR2 was expressed through the entire leaf epidermis, most strongly in trichomes and guard cells of the stomatal apparatus. In the cross section of culm,GUS staining was observed specifically in endodermal cells, with no blue staining in epidermal or vascular bundle cells. In glumous flower, GUS staining was restricted to the anther of the stamens, the paleas and lemmas, and especially in the trichomes of paleas and lemmas. However, no expressionwas found in the filaments of stamens and any part of the pistil including stigmas, styles and ovaries. When anthers were observed by phase-contrast microscopy, only the microspores showed GUS staining. In addition, intense GUS staining was observed in the seed embryo (scutellum, epiblast, plumule and rachilla) with only faint staining in starchy endosperm (Fig. 1b). The ubiquitous expression pattern of OsWR2 suggests that OsWR2 is expressed in a variety of tissues, intimating that cuticle plays a role in diverse developmental processes in rice. For analyzing the responses of OsWR2 to abiotic stresses, 3-week-old rice seedlings were treated with water deficit in the potting medium for 5 days or with 150mMNaCl for 8 h. Semiquantitative RT-PCR analysis showed that both water deficit and NaCl treatments enhanced the expression of OsWR2 (Fig. 1c), suggesting that OsWR2 mayplayan important role in plant response to stresses. OsWR2 expression was increased more under dehydration treatment than NaCl treatment.
 
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
 +
* The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
 +
* The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
 +
* The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
 +
* Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.<ref name="ref3" />
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
 +
* Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)
 +
 
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF
 +
gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32.
 +
PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
 +
</ref>
 +
* <ref name="ref2">
 +
Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet
 +
meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov
 +
8;298(5596):1238-41. PubMed PMID: 12424380.
 +
</ref>
 +
* <ref name="ref3">
 +
Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription
 +
factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.
 +
</ref>
 +
</references>
 +
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os06g0604000|
 
Description = Similar to Ethylene response factor 1|
 
Version = NM_001064549.2 GI:297606135 GeneID:4341466|
 
Length = 1563 bp|
 
Definition = Oryza sativa Japonica Group Os06g0604000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:24775260..24776822|
 
CDS = 24775899..24775916,24776044..24776275,24776508..24776590|
 
GCID = <gbrowseImage1>
 
name=NC_008399:24775260..24776822
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:24775260..24776822
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgggacagtcgaagaagaagttccgcggagtcaggcagcgccactggggctcctgggtctccgagatcaggcaccctctccttaagaggagggtgtggctgggtacctttgagacggcggaggaggcggcgcgggcgtacgacgaggccgccatcctgatgagcggccgcaacgccaagaccaacttcccagtcgcgaggaacgccacgggggagctcacaccggcggctgcggtggcagggcgggatggccgtgtcggcggcggcagcggcagctcgtcctcaatgacggccaacggcggcgggaacagcctgactccagctgggtcatga</cdnaseq>|
 
AA = <aaseq>MGQSKKKFRGVRQRHWGSWVSEIRHPLLKRRVWLGTFETAEEAA                    RAYDEAAILMSGRNAKTNFPVARNATGELTPAAAVAGRDGRVGGGSGSSSSMTANGGG                    NSLTPAGS</aaseq>|
 
DNA = <dnaseqindica>907..924#548..779#233..315#attgaacgcacgctacactgcaagaaaggcaagtataggggtggcaggtagtttatattcactggaaaccgagaacttcactcctcccagcactccacactaggaggatgctcactgtctgactgactgactggctgctgctgctgctcattccttctcctactctgcctgcctcctctgctgtgtccttgggagaattcttcagggacagtatccctgcagaggtgagatcatgggacagtcgaagaagaagttccgcggagtcaggcagcgccactggggctcctgggtctccgagatcaggcaccctctcctgtaagtctctatctcactagtgatgatcactagctagctatgttgctctgatgtgttatgccactgtcgtgatagatacattttgatggatagctagtggttctggtttgttgttgctttctttctttttttctttctctttcatggtatgttagtagctaactcaaggtgcttgggtgcgtgcatgcatgaatgatggatgatgttttttttgctacgtgcgttgtggcagtaagaggagggtgtggctgggtacctttgagacggcggaggaggcggcgcgggcgtacgacgaggccgccatcctgatgagcggccgcaacgccaagaccaacttcccagtcgcgaggaacgccacgggggagctcacaccggcggctgcggtggcagggcgggatggccgtgtcggcggcggcagcggcagctcgtcctcaatgacggccaacggcggcgggaacagcctgtctcagatcctcagcgccaagctccgcaagtgctgcaagacgccgtcgccgtcgctcacctgcctccgccttgacccggagaagtcccacattggcgtctggcagaagcgcgccggcgcacgcgctgactccagctgggtcatgaccgtcgagctcaacaaggacacggccgtgtcgtcggctgcgacggtggcagcagcaacagcagtgtcgtccagcgaccagccgactccgagtgacagcacagtcacaacgacgtccacgtccaccacgggctcgccgtcgccaccacctccggcaatggacgacgaggagaggatcgcgctgcagatgatcgaggagctgctgggcaggagcggcccgggctcgccgtcacatgggctgctgcacggtggtgaaggtagcctcgtcatctgaattccggaagaacaggaaagaaattgaaaatgcaaggttaaaacagcatgatcaggtcaccatctaagatcaaggatctggtagggtggttggtgcacaggcagttaagattgctacatatgataggtatatctctattactactacatatccagcttaattaggaaacaattataagatcgattactactgtgtgaagtgaagctgtgtatttattaaagacttacttgtatgtacaagacgtccccgtcattatagtcatactggtgaaagctctgctatgtatcaacgtcatcagagatcagactacatatatataagtggtgtcaacttctaataaaagtaaataaaaacattgtaattgtgt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001064549.2 RefSeq:Os06g0604000]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:02, 23 March 2017

The rice Os06g0604000 was reported as OsERF#001 in 2006 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os06g0604000 <=> OsERF#001

Function

  • Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
  • It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
  • Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).[2]

Evolution

  • The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
  • The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
  • The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
  • The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
  • Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.[3]

You can also add sub-section(s) at will.

Labs working on this gene

  • Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
  • Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)


References

  1. Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32. PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
  2. Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov 8;298(5596):1238-41. PubMed PMID: 12424380.
  3. Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.


Structured Information