Difference between revisions of "Os04g0546800"

From RiceWiki
Jump to: navigation, search
(References)
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os04g0546800''''' was reported as '''''OsERF#093''''' in 2006 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os04g0546800''''' '''''<=>''''' '''''OsERF#093'''''
 +
 
===Function===
 
===Function===
 
+
* Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
The protein encoded by OsERF1 in rice is a member of the ERF subgroup. Besides having the AP2/EREBP DNA-binding domain, it contains an alanine-rich and a serine-rich region, which have been proposed to compose a transcriptional activation domain in other transcription factors. These features, in combination with its acidic pI, relative hydrophilicity and nuclear localization, suggest that OsERF1 is a potential transcription factor.
+
* It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
 
+
* Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).<ref name="ref2" />
OsERF1 expresses consistently and can be up-regulated by ethylene in a dose-dependent manner
 
 
 
OsERF1expr ession patt ern was analyz ed by semi-quan titative RT-PCR. OsERF1 was expressed almost equally in roots, leaves, inflorescences and buds ; in developing flowers its transcripts were accumulated equally from the male meiotic stage to mature pollen stage
 
 
 
Overexpression of OsERF1 in Arabidopsis causes similar phenotypes as in transgenic plants that overexpress known ethylene-responsive factors
 
 
 
The overexpression construct of OsERF1and the pCAMBIA1302 vector (control) were introduced into Arabidopsis. It showed that overexpression of OsERF1 results in the aberrant phenotypes.
 
 
 
OsERF1 can activate expression of ethylene-responsive genes
 
 
 
Transgenic seedlings showed short hypocotyls and roots but exaggerated hooks were not observed, which was similar to ERF1-overexpressed Arabidopsis plants. In OsERF1-overexpressed Arabidopsis plants, examination of the expression of two ethylene-responsive genes b-chitinase and PDF 1.2, which work at the down stream of ERF1 in Arabidopsis, showed that both of them were up-regulated.
 
 
 
===Expression===
 
 
 
The transcriptional level of OsERF1 increased (>20%) by 0.1 mM ethrel inducement. Further more, 1 mM ethrel was used to confirm the response of OsERF1. Compared with the control, OsERF1 mRNA accumulation increased obvious ly (>70%) after 4h inducement.
 
  
 
===Evolution===
 
===Evolution===
 +
* The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
 +
* The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
 +
* The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
 +
* The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
 +
* Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.<ref name="ref3" />
  
 
+
You can also add sub-section(s) at will.
OsERF1 shared high sequence identity (≥80.83%) with other ERFs, relatively low identity (≤65.98%) with DREBs and conside rably low ide ntity (≤37.7%) with APETALA2 proteins. In addition, the conserved 15th A and 20th D in the domain of EFRs, but not DREBs , are present in OsERF1. Phylogenetic analysis based on alignm ent of full amino acid sequences also revealed that OsERF1 tended to group into the known ERFs but not DREBs. Consistent with these results, a previous bioinformatic analysis shows the gene predicted on the basis of rice genomic sequences belongs to the B-3/ IX group of rice ERF gene subfamily; and characterized genes from the B-3/ IX group such as ERF1 and Pti4 are identified to be ethylene-responsive.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
 +
* Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)
  
 
==References==
 
==References==
 
+
<references>
Yibing Hu, Lifeng Zhao, Kang Chong, Tai Wang. Overexpression of OsERF1, a novel rice ERF gene, up-regulates ethylene-responsive genes expression besides affects growth and development in Arabidopsis. Journal of Plant Physiology 165 (2008) 1717—1725.
+
* <ref name="ref1">
 
+
Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF
Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF gene family in Arabidopsis and rice. Plant Physiol 2006;140:411–32.
+
gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32.
 
+
PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
Jofuku KD, den Boer BG, Van Montagu M, Okamuro JK.Control of Arabidopsis flower and seed development by the homeotic gene APETALA2. Plant Cell 1994;6:1211–25.
+
</ref>
 
+
* <ref name="ref2">
Solano R, Stepanova A, Chao Q, Ecker JR. Nuclear events in ethylene signaling: a transcriptional cascade mediated by ETHYLENE-INSENSITIVE3 and ETHYLENE  RESPONSE-FACTOR1. Genes Dev 1998;12:3703–14.
+
Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet
 
+
meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov
 +
8;298(5596):1238-41. PubMed PMID: 12424380.
 +
</ref>
 +
* <ref name="ref3">
 +
Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription
 +
factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.
 +
</ref>
 +
</references>
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os04g0546800|
 
Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|
 
Version = NM_001060009.2 GI:297603127 GeneID:4336571|
 
Length = 1606 bp|
 
Definition = Oryza sativa Japonica Group Os04g0546800, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
 
AP = Chromosome 4:27769804..27771409|
 
CDS = 27770368..27771324|
 
GCID = <gbrowseImage1>
 
name=NC_008397:27769804..27771409
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008397:27769804..27771409
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgacggcgcgaagcatgttgcggaaccacccggaggcgtcggtgctcgacaccatccggcagcacctgctggaggagccgcgcggcggcggcggtggcgaggcggcggaggcgagcttcgggagcctggtggccgacatgtggagcgactcgctgccgttccgcgacgacgacgccgacgacatggtggtgttcggcgcgatgcgggacgcgttctcgtgcgggtggctgcccgacggcgtgttcgcggaggtgaagccggagcccctgctctcgccggactcgtcgtcgtacgacgggtcctcttgctgcttcggcttcgcggacgtgtcggagccggtgacgccgagcgacgcggcgtcgggggcggcagaagcggcggccgcggcggcggcggcgacggcggagcacgggaaggaggaggaggccgcggctgcggtggcgagggggaagcactacaggggggtgaggcagcggccgtggggcaagttcgcggcggagatccgggaccccgccaagaacggcgcgcgcgtgtggctcggcacgttcgacaccgccgaggacgccgccctggcgtacgaccgcgccgcctaccgcatgcgtggctcccgcgcgctcctcaacttcccgctccgcatcggctcggagatcgcagccgccgccgccgccgcagcggcagcggcagccggcgacaagcggccgtcgccggagccggcgacctcggagtcgtccttctcctcctcatcctcctgcaccaccaccaccacctcctcctcaacctcctcctccggctccccgaaacggagaaagagaggcgaggccgcggccgcgtccatgtccatgcccctggtgcccccgccttcccagctgaactggccggtgcaggcatggtaccccgccgccgcaccggtcgagcaggtggcgatcaccccgcgcgtggagcagctcgtcatctaa</cdnaseq>|
 
AA = <aaseq>MTARSMLRNHPEASVLDTIRQHLLEEPRGGGGGEAAEASFGSLV                    ADMWSDSLPFRDDDADDMVVFGAMRDAFSCGWLPDGVFAEVKPEPLLSPDSSSYDGSS                    CCFGFADVSEPVTPSDAASGAAEAAAAAAAATAEHGKEEEAAAAVARGKHYRGVRQRP                    WGKFAAEIRDPAKNGARVWLGTFDTAEDAALAYDRAAYRMRGSRALLNFPLRIGSEIA                    AAAAAAAAAAAGDKRPSPEPATSESSFSSSSSCTTTTTSSSTSSSGSPKRRKRGEAAA                    ASMSMPLVPPPSQLNWPVQAWYPAAAPVEQVAITPRVEQLVI</aaseq>|
 
DNA = <dnaseqindica>86..1042#accattcaactcgaacacaccacacactgaagtgtgtaaccaagtttgagacagaggcgaggtcgggtcagcaaggaagacggcgatgacggcgcgaagcatgttgcggaaccacccggaggcgtcggtgctcgacaccatccggcagcacctgctggaggagccgcgcggcggcggcggtggcgaggcggcggaggcgagcttcgggagcctggtggccgacatgtggagcgactcgctgccgttccgcgacgacgacgccgacgacatggtggtgttcggcgcgatgcgggacgcgttctcgtgcgggtggctgcccgacggcgtgttcgcggaggtgaagccggagcccctgctctcgccggactcgtcgtcgtacgacgggtcctcttgctgcttcggcttcgcggacgtgtcggagccggtgacgccgagcgacgcggcgtcgggggcggcagaagcggcggccgcggcggcggcggcgacggcggagcacgggaaggaggaggaggccgcggctgcggtggcgagggggaagcactacaggggggtgaggcagcggccgtggggcaagttcgcggcggagatccgggaccccgccaagaacggcgcgcgcgtgtggctcggcacgttcgacaccgccgaggacgccgccctggcgtacgaccgcgccgcctaccgcatgcgtggctcccgcgcgctcctcaacttcccgctccgcatcggctcggagatcgcagccgccgccgccgccgcagcggcagcggcagccggcgacaagcggccgtcgccggagccggcgacctcggagtcgtccttctcctcctcatcctcctgcaccaccaccaccacctcctcctcaacctcctcctccggctccccgaaacggagaaagagaggcgaggccgcggccgcgtccatgtccatgcccctggtgcccccgccttcccagctgaactggccggtgcaggcatggtaccccgccgccgcaccggtcgagcaggtggcgatcaccccgcgcgtggagcagctcgtcatctaaagcgcgcgacgcacagtgaagcaagcaaaccaagccagcaatggtcgacgtcatatcaccttgacgccccaacggattgaccagcgagcacgagccagccattgctttgcacggcgcgagacggcaaagggatcaggcgatggaaccccgtgagcgcgacggcgcaagcgagcagcatccccgcgaaagctccaccggatgcaaaattgcaaacgcgataagctcgcgggtgcaactggtgaaattgggtggtgcaatcgtgtgtgggcgagctctagcagatagtagcgtggtggtggtggtggtattgttgtcccggcgcaactcgcccaagtgggggggtgaggaggatactctgtgtctactagcgtgttcttgtcagggaatgcacggtgtcgtcaagtgtgcaaatcctaagggtcataattcgcgtcattgtcactagtggatcacccgagtgagtttgtgagggtttcagtgaaaaaaaaaaactgtacaaacgatgtcttgtggtgtggagaagcagcagagatgaagaacaatcaatcatcccctttgttcttt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060009.2 RefSeq:Os04g0546800]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:36, 23 March 2017

The rice Os04g0546800 was reported as OsERF#093 in 2006 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os04g0546800 <=> OsERF#093

Function

  • Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
  • It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
  • Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).[2]

Evolution

  • The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
  • The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
  • The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
  • The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
  • Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.[3]

You can also add sub-section(s) at will.

Labs working on this gene

  • Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
  • Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)

References

  1. Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32. PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
  2. Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov 8;298(5596):1238-41. PubMed PMID: 12424380.
  3. Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.

Structured Information