Difference between revisions of "Os03g0150200"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os03g0150200''''' was reported as '''''OsERF#088''''' in 2006 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os03g0150200''''' '''''<=>''''' '''''OsERF#088'''''
 +
 
===Function===
 
===Function===
This gene was isolated using the yeast-one-hybrid system. The screened cDNA was named OsAP23 (GenBank accession number: AY339376). The sequencing results indicated that OsAP23 contained a 426-bp open reading frame (ORF) and encoded a 141-amino-acid protein (Supplementary Fig. 1). The OsAP23 gene was located on rice chromosome number 3. This gene encodes the GCC-box binding protein.
+
* Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
To investigate the putative role of OsAP23 in response to abiotic stress, the OsAP23 gene was over-expressed under the control of the CaMV 35S promoter in transgenic Arabidopsis plants.The growth of the transgenic and wild-type plants was similar when subjected to cold, heat, or drought stress. But the germination of the transgenic Arabidopsis plants that overexpress the OsAP23 gene became more severely inhibited as the NaCl concentration increased. The germination rates were much lower on MS media containing 150 mM NaCl than on MS medium containing 100 mM NaCl.These results indicated that OsAP23 negatively regulated high salt tolerance, at least during germination and early vegetative growth.
+
* It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
===Expression===
+
* Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).<ref name="ref2" />
To evaluate the over-expression of the OsAP23 gene in transgenic Arabidopsis plants subjected to high salt stress, the expression of several stress-responsive genes in regulated pathways was monitored using semi-quantitative RT-PCR analysis.Before being subjected to high salt conditions, the expression levels of the rd29a, rd29b, and rd22 genes in wild-type Arabidopsis plants were similar to those in the transgenic plants. For the high-salt treatments, 4-week-old seedlings were transferred to solutions containing 250 mM NaCl for 12 h. Although salt stress increased the levels of all the three genes in both groups of Arabidopsis, The expression levels of rd29a, rd29b, and rd22 in the transgenic plants were less than the expression levels recorded in wild-type plants.
+
 
 
===Evolution===
 
===Evolution===
Sequence analysis revealed that OsAP23 contained a single AP2 DNA-binding domain that comprised 58 amino acids and was located in the N-terminal region of OsAP23. The putative amino acid sequence for the rice OsAP23 protein was compared with known AP2/ERF proteins from Arabidopsis. These proteins shared a high degree of homology in the AP2 DNA-binding domain. In order to classify OsAP23 into a subfamily of the AP2/ERF family, AP2/ERF proteins from Arabidopsis were aligned with OsAP23 to create the phylogenetic tree. The results showed that OsAP23 belonged to the B3 group of the ERF subfamily.
+
* The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
 +
* The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
 +
* The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
 +
* The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
 +
* Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.<ref name="ref3" />
 +
 
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Enhancement, Ministry of Agriculture Key Laboratory of Biology and Germplasm Enhancement of Horticultural Crops in East China, College of Horticulture, Nanjing Agricultural University.
+
* Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
 +
* Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
1.Jing Zhuang, Hai-Hua Jiang, Feng Wang, Ri-He Peng, Quan-Hong Yao, Ai-Sheng Xiong. (2013) A rice OsAP23, functioning as an AP2/ERF transcription factor, reduces salt tolerance in transgenic arabidopsis. Plant Mol Biol Rep (2013) 31:1336–1345
+
* <ref name="ref1">
 +
Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF
 +
gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32.
 +
PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
 +
</ref>
 +
* <ref name="ref2">
 +
Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet
 +
meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov
 +
8;298(5596):1238-41. PubMed PMID: 12424380.
 +
</ref>
 +
* <ref name="ref3">
 +
Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription
 +
factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os03g0150200|
 
Description = Similar to Ethylene-responsive transcription factor 5 (Ethylene-responsive element binding factor 5 homolog) (EREBP-4) (NtERF4)|
 
Version = NM_001055510.1 GI:115450748 GeneID:4331633|
 
Length = 633 bp|
 
Definition = Oryza sativa Japonica Group Os03g0150200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:2778626..2779258|
 
CDS = 2778674..2779099|
 
GCID = <gbrowseImage1>
 
name=NC_008396:2778626..2779258
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:2778626..2779258
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggaggacgacaagagtaaggaggggaaatcgtcgtcgtcgtaccgcggcgtgcggaagcggccgtggggcaagttcgcggcggagatccgcgacccggagcgcgggggagcccgcgtgtggctcggcacgttcgacaccgcggaggaggccgcgcgggcgtacgaccgcgccgcattcgccatgaagggcgccacggccatgctcaacttcccgggagatcatcatcacggcgccgcaagcaggatgaccagcaccggctcttcttcgtcctccttcaccacgcctcctccggcgaactcctccgcggcggcgggccgcggcggctccgatcggacgacggacaaggtggagctggagtgcctcgacgacaaggtcctggaggacctcctcgcggagaccaactatcgtgataagaactactag</cdnaseq>|
 
AA = <aaseq>MEDDKSKEGKSSSSYRGVRKRPWGKFAAEIRDPERGGARVWLGT                    FDTAEEAARAYDRAAFAMKGATAMLNFPGDHHHGAASRMTSTGSSSSSFTTPPPANSS                    AAAGRGGSDRTTDKVELECLDDKVLEDLLAETNYRDKNY</aaseq>|
 
DNA = <dnaseqindica>49..474#ccaatcggcgtcgtcaggcctctcgcgtgtgcgagcggttgcgtccgcatggaggacgacaagagtaaggaggggaaatcgtcgtcgtcgtaccgcggcgtgcggaagcggccgtggggcaagttcgcggcggagatccgcgacccggagcgcgggggagcccgcgtgtggctcggcacgttcgacaccgcggaggaggccgcgcgggcgtacgaccgcgccgcattcgccatgaagggcgccacggccatgctcaacttcccgggagatcatcatcacggcgccgcaagcaggatgaccagcaccggctcttcttcgtcctccttcaccacgcctcctccggcgaactcctccgcggcggcgggccgcggcggctccgatcggacgacggacaaggtggagctggagtgcctcgacgacaaggtcctggaggacctcctcgcggagaccaactatcgtgataagaactactagctagctagctactatggctacttagctagtacataccgatccgtcggtattagcaagacggacatggagcagtcgtgatctcgtctgtatgcgctccttgaaacgatcgagaccatgagcttgctagctagctacgcatagtagtagcaataacagagg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055510.1 RefSeq:Os03g0150200]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:40, 23 March 2017

The rice Os03g0150200 was reported as OsERF#088 in 2006 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os03g0150200 <=> OsERF#088

Function

  • Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
  • It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
  • Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).[2]

Evolution

  • The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
  • The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
  • The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
  • The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
  • Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.[3]

You can also add sub-section(s) at will.

Labs working on this gene

  • Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
  • Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)

References

  1. Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32. PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
  2. Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov 8;298(5596):1238-41. PubMed PMID: 12424380.
  3. Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.

Structured Information