Difference between revisions of "Os05g0497200"

From RiceWiki
Jump to: navigation, search
 
(19 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os05g0497200''''' was reported as '''''OsERF#130''''' in 2006 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os05g0497200''''' '''''<=>''''' '''''OsERF#130'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
 
+
* It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
===Expression===
+
* Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).<ref name="ref2" />
Please input expression information here.
 
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
 +
* The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
 +
* The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
 +
* The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
 +
* Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.<ref name="ref3" />
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
 +
* Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 
+
* <ref name="ref1">
 +
Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF
 +
gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32.
 +
PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
 +
</ref>
 +
* <ref name="ref2">
 +
Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet
 +
meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov
 +
8;298(5596):1238-41. PubMed PMID: 12424380.
 +
</ref>
 +
* <ref name="ref3">
 +
Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription
 +
factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.
 +
</ref>
 +
</references>
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os05g0497200|
 
Description = Similar to Ethylene-responsive transcription factor 11 (Ethylene-responsive element binding factor 11) (EREBP-11) (AtERF11)|
 
Version = NM_001062476.2 GI:297604695 GeneID:4339208|
 
Length = 915 bp|
 
Definition = Oryza sativa Japonica Group Os05g0497200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
 
AP = Chromosome 5:24475113..24476027|
 
CDS = 24475273..24475842|
 
GCID = <gbrowseImage1>
 
name=NC_008398:24475113..24476027
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008398:24475113..24476027
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggagctggacatgggagcgggaggaggcggtggagtagtgggaggtgggcgagcggaggcgcactaccgcggggtgaggaagcggccgtggggccggtacgcggcggagatccgggacccgtggaagaagacgcgggtgtggctcggcacctacgacacgcccgtcgaggccgcgctcgcctacgaccgcgccgccgtcgcgctccgcggcgtcaaggcgcggaccaacttcggcagcggcagcagcggtggtggtggcgtcggcgggcacggccatggccacagccacgcccagctgccgcagcttcaccaccgcatgcacccgccgcggccgccgcagggccctggtcacttcggcgggctcgacatcagccacccttcgccgtggcactatgtctacttcccggcgagggtgcaggcgatggcgccggcggcggctggccatgtcgcggcgcacgtcgccgcgtcgctgccgtcgacgacgctggagctccggacggggccgagcgccggcgagctcccgttcgacctcaacgagccgccgccggcgctgctgttcggctcgtga</cdnaseq>|
 
AA = <aaseq>MELDMGAGGGGGVVGGGRAEAHYRGVRKRPWGRYAAEIRDPWKK                    TRVWLGTYDTPVEAALAYDRAAVALRGVKARTNFGSGSSGGGGVGGHGHGHSHAQLPQ                    LHHRMHPPRPPQGPGHFGGLDISHPSPWHYVYFPARVQAMAPAAAGHVAAHVAASLPS                    TTLELRTGPSAGELPFDLNEPPPALLFGS</aaseq>|
 
DNA = <dnaseqindica>186..755#ggcgcgcgcaaacgcaaagccgacgcgagagcgagcggccaccgcgcgctagtagtagtagcgagccactatagatttggctcccgtataaagggtcgctgagacttgcttgtcgctggcagtggcagctgccgatccgtccgtcaaggcacagcgcaagcacaggctctcgctcgtggaggcgaatggagctggacatgggagcgggaggaggcggtggagtagtgggaggtgggcgagcggaggcgcactaccgcggggtgaggaagcggccgtggggccggtacgcggcggagatccgggacccgtggaagaagacgcgggtgtggctcggcacctacgacacgcccgtcgaggccgcgctcgcctacgaccgcgccgccgtcgcgctccgcggcgtcaaggcgcggaccaacttcggcagcggcagcagcggtggtggtggcgtcggcgggcacggccatggccacagccacgcccagctgccgcagcttcaccaccgcatgcacccgccgcggccgccgcagggccctggtcacttcggcgggctcgacatcagccacccttcgccgtggcactatgtctacttcccggcgagggtgcaggcgatggcgccggcggcggctggccatgtcgcggcgcacgtcgccgcgtcgctgccgtcgacgacgctggagctccggacggggccgagcgccggcgagctcccgttcgacctcaacgagccgccgccggcgctgctgttcggctcgtgatctcgacacgtacgtgagtagagcatcactgggtagtactaggaccaaggatcaagcttagagatcactagtagataggggtaaccgattaatgtgggagtggagagcactggtccggctgtgtacatacgtactactatttaaggaaagtttagcgttc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062476.2 RefSeq:Os05g0497200]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:47, 23 March 2017

The rice Os05g0497200 was reported as OsERF#130 in 2006 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os05g0497200 <=> OsERF#130

Function

  • Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
  • It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
  • Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).[2]

Evolution

  • The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
  • The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
  • The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
  • The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
  • Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.[3]

You can also add sub-section(s) at will.

Labs working on this gene

  • Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
  • Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)

References

  1. Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32. PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
  2. Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov 8;298(5596):1238-41. PubMed PMID: 12424380.
  3. Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.

Structured Information