Difference between revisions of "Os03g0183000"

From RiceWiki
Jump to: navigation, search
(Function: OsRAF is an ethylene responsive and root abundant factor gene of rice)
 
(11 intermediate revisions by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os03g0183000''''' was reported as '''''OsERF#062''''' in 2006 <ref name="ref1" /> by researchers from Japan.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os03g0183000''''' '''''<=>''''' '''''OsERF#062'''''
 +
 
===Function===
 
===Function===
AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.
+
* Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP
+
* It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF
+
* Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).<ref name="ref2" />
accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.
 
 
 
===Expression===
 
AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others. In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.
 
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
 +
* The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
 +
* The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
 +
* The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
 +
* Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.<ref name="ref3" />
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
 +
* Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 
+
* <ref name="ref1">
==Structured Information==
+
Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF
{{JaponicaGene|
+
gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32.
GeneName = Os03g0183000|
+
PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
Description = Similar to AP2 domain containing protein RAP2.6 (Fragment)|
+
</ref>
Version = NM_001055712.1 GI:115451152 GeneID:4331845|
+
* <ref name="ref2">
Length = 1794 bp|
+
Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet
Definition = Oryza sativa Japonica Group Os03g0183000, complete gene.|
+
meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov
Source = Oryza sativa Japonica Group
+
8;298(5596):1238-41. PubMed PMID: 12424380.
 
+
</ref>
  ORGANISM  Oryza sativa Japonica Group
+
* <ref name="ref3">
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
</ref>
|
+
</references>
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
 
AP = Chromosome 3:4327072..4328865|
 
CDS = 4327660..4328399,4328509..4328773|
 
GCID = <gbrowseImage1>
 
name=NC_008396:4327072..4328865
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008396:4327072..4328865
 
source=RiceChromosome03
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtgtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctga</cdnaseq>|
 
AA = <aaseq>MCGGAILAEFIPAPSRAAAATKRVTASHLWPAGSKNAARGKSKS                    KRQQRSFADVDDFEAAFEQFDDDSDFDDAEEEDEGHFVFASKSRVVAGHDGRAAARAA                    SKKKRGRHFRGIRQRPWGKWAAEIRDPHKGTRVWLGTFNTPEEAARAYDVEARRLRGS                    KAKVNFPATPAAARPRRGNTRATAVPPPATAPAAAPPRGLKREFSPPAETALPFFTNG                    FVDLTTAAAPPPAMMMTSSFTDSVATSESGGSPAKKARSDDVDSSEGSVGGGSDTLGF                    TDELEFDPFMLFQLPYSDGYESIDSLFAAGDANSANTDMNAGVNLWSFDDFPIDGALF                    </aaseq>|
 
DNA = <dnaseqindica>467..1206#93..357#aaaggcattcgcaacacacacttgaagaaaaaaaacacgacgaacacgttaaaaaaaggtcgaagagaagtgggagacccaaaccgcgaacaatgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtggtaatgttcgtcgcgtgcgatctcgtctaggtgttcgatcgtgatggcgatgagttcttggcttgatctcaccgaggaagattggtttggtttggttttgttcgtgcagtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctgatgtactcctccattgatgcagtttgtgcactcaattgtaagcatctgaattcacttccattttaatggattcagttaaaaacttaaaatccatctgttcatcaggattatatatcttgatcagataccatgccatttcttggttcaggttaatcacgtcgtcgttgatgaatgtttaaccggaggatgatggggtgcagctgatatcatggcttgcttgattaccgaattatattgcggtgtttgtgtttgtcaattagattctgaatctgtactactgccgatcttatgatcaaaactatatattaagtttatgtactcttaatttgtgggctacttttacggggtcttcgtactgctggtcaaatagtcctatgaaatcgatcatgtcggcaatatcgtcgtcaattatcgtggtcgtggttgttaatgatgtcaaataagtctatgaaaacctggtcctcttggtgtttatgtaccactgatcgatccatcatttgatctctgtcatgttgagatggatcgtgtaagaatatcataatttgctggattcagtccagtcgtaatgtattttggtttgtacaactgc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055712.1 RefSeq:Os03g0183000]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 3]]
 
[[Category:Chromosome 3]]
 

Latest revision as of 09:01, 23 March 2017

The rice Os03g0183000 was reported as OsERF#062 in 2006 [1] by researchers from Japan.

Annotated Information

Gene Symbol

  • Os03g0183000 <=> OsERF#062

Function

  • Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
  • It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
  • Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).[2]

Evolution

  • The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
  • The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
  • The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
  • The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
  • Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.[3]

You can also add sub-section(s) at will.

Labs working on this gene

  • Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
  • Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)

References

  1. Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32. PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
  2. Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov 8;298(5596):1238-41. PubMed PMID: 12424380.
  3. Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.