Difference between revisions of "Os09g0541000"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
 
(4 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os09g0541000''''' was reported as '''''OsPIP2;7''''' in 2008 <ref name="ref1" /> by researchers from China.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os09g0541000''''' '''''<=>''''' '''''OsPIP2;7, PIP2.7, PIP2-7, OsPIP2-6'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* '''''OsPIP2;7''''' was involved in rapid water transport and maintenance of the water balance in cells, and ultimately improves the tolerance of yeast and rice to low temperature stress.
 +
 
 +
===Phenotypic analysis===
 +
* Yeast cells overexpressing OsPIP2;7 showed a higher survival rate after freeze–thaw stress.
 +
* Furthermore, OsPIP2;7 enhanced the transpiration rate and tolerance to low temperature when overexpressed in rice.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* '''''OsPIP2;7''''' was generally up-regulated in roots but down-regulated in shoots at the early stage of chilling stress.
 
 
===Evolution===
 
Please input evolution information here.
 
  
You can also add sub-section(s) at will.
+
===Subcellular localization===
 +
* '''''OsPIP2;7''''' was localized mainly in mesophyll cells of leaves.
 +
* In roots '''''OsPIP2;7''''' was detected in the vascular tissues, epidermis cells and exodermis cells at the elongation zone, as well as in the epidermis cells, exodermis cells and root hair at the maturation zone.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences and Graduate School of the Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, PR China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Li GW, Zhang MH, Cai WM, Sun WN, Su WA. Characterization of OsPIP2;7, a water
 +
channel protein in rice. Plant Cell Physiol. 2008 Dec;49(12):1851-8. doi:
 +
10.1093/pcp/pcn166. PubMed PMID: 18988636.
 +
 
 +
</ref>
 +
 
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 9]]
GeneName = Os09g0541000|
 
Description = Similar to Plasma membrane intrinsic protein (Aquaporin)|
 
Version = NM_001070347.1 GI:115480436 GeneID:4347729|
 
Length = 1266 bp|
 
Definition = Oryza sativa Japonica Group Os09g0541000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:22141777..22143042|
 
CDS = 22141808..22142236,22142336..22142557,22142659..22142781|
 
GCID = <gbrowseImage1>
 
name=NC_008402:22141777..22143042
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:22141777..22143042
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgtcgaaggaggaggtggccgtggagacggtggagggcggagcggcggcggcgaaggcgccgtactgggacccgccgccggcgccgctgctggacacgagcgagctgggtaagtggtcgctgtaccgtgccctcatcgcggagttcatggcgacgctcatcttcctctacgtgagcatcgccaccgtgatcgggtacaagaaccagagggccaccgtcgacgcgtgcaccggcgtcggctacctcggcgtggcgtggtcgttcggtgccaccatattcgtcctcgtctactgcaccggcggcgtctccggcgggcacatcaacccggcggtgacgctgggcctcttcttcgggcggaagctgtcgctcgtccgcaccgtgctgtacgtcgtggcgcagtgcctcggcgccatcgccggcgccggcatcgtcggcacgttcatcctcgtctacaccgtcttctccgccaccgaccccaagcgcaccgcccgcgactccttcatccccgtactcgtgccgctgccgatcgggttcgcggtgttcgtcgtgcacctggcgacgattccgatcaccggcacgggcatcaacccggcgaggagcctcggcgccgccgtgctgtacaaccagcacgcagcttggaaagaccactggatcttctgggtggggccggtgatcggggcgttcttggcggcggcgtaccacaagctggtgctgcgcggcgaggccgccaaggcgctcagctcgttcaggagcaccagcgtgacggcgtga</cdnaseq>|
 
AA = <aaseq>MASKEEVAVETVEGGAAAAKAPYWDPPPAPLLDTSELGKWSLYR                    ALIAEFMATLIFLYVSIATVIGYKNQRATVDACTGVGYLGVAWSFGATIFVLVYCTGG                    VSGGHINPAVTLGLFFGRKLSLVRTVLYVVAQCLGAIAGAGIVGTFILVYTVFSATDP                    KRTARDSFIPVLVPLPIGFAVFVVHLATIPITGTGINPARSLGAAVLYNQHAAWKDHW                    IFWVGPVIGAFLAAAYHKLVLRGEAAKALSSFRSTSVTA</aaseq>|
 
DNA = <dnaseqindica>32..460#560..781#883..1005#ttcgtggtgataaggagtaggagagaaggccatggcgtcgaaggaggaggtggccgtggagacggtggagggcggagcggcggcggcgaaggcgccgtactgggacccgccgccggcgccgctgctggacacgagcgagctgggtaagtggtcgctgtaccgtgccctcatcgcggagttcatggcgacgctcatcttcctctacgtgagcatcgccaccgtgatcgggtacaagaaccagagggccaccgtcgacgcgtgcaccggcgtcggctacctcggcgtggcgtggtcgttcggtgccaccatattcgtcctcgtctactgcaccggcggcgtctccggcgggcacatcaacccggcggtgacgctgggcctcttcttcgggcggaagctgtcgctcgtccgcaccgtgctgtacgtcgtggcgcagtgcctcggcgccatcgccggcgccggcatcgtcaaggggatcatgaagcgcccctacgacgcgctcggcggcggcgccaacaccgtcagcgacggctactccgccgccggcgccctcggcgccgagatcgtcggcacgttcatcctcgtctacaccgtcttctccgccaccgaccccaagcgcaccgcccgcgactccttcatccccgtactcgtgccgctgccgatcgggttcgcggtgttcgtcgtgcacctggcgacgattccgatcaccggcacgggcatcaacccggcgaggagcctcggcgccgccgtgctgtacaaccagcacgcagcttggaaagaccacgtgagagagaacgaacaaaattaaattcattcgaatagattcacttcttaaaactttttcttaatcaatcgactagtaattaatttgatgaattttggcagtggatcttctgggtggggccggtgatcggggcgttcttggcggcggcgtaccacaagctggtgctgcgcggcgaggccgccaaggcgctcagctcgttcaggagcaccagcgtgacggcgtgaggaagacgacgatgttcatttgatacgagagatcgatcagctgcttgattaattgttcttgatttcgttgttcaatttacaatctacgactatggacgatcatgcatatgatatgatcgatgcatgcgtctgttgtcagttttatttgggactttcagtgtgagagtgtgaatggttgtaaaataagtggagtgcctgtatgtatctgtatgcatgcacggcacggtacgcgtgtttatggatgatgctttgttacgtagc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070347.1 RefSeq:Os09g0541000]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 9]]
 
[[Category:Chromosome 9]]
 

Latest revision as of 14:16, 25 March 2017

The rice Os09g0541000 was reported as OsPIP2;7 in 2008 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os09g0541000 <=> OsPIP2;7, PIP2.7, PIP2-7, OsPIP2-6

Function

  • OsPIP2;7 was involved in rapid water transport and maintenance of the water balance in cells, and ultimately improves the tolerance of yeast and rice to low temperature stress.

Phenotypic analysis

  • Yeast cells overexpressing OsPIP2;7 showed a higher survival rate after freeze–thaw stress.
  • Furthermore, OsPIP2;7 enhanced the transpiration rate and tolerance to low temperature when overexpressed in rice.

Expression

  • OsPIP2;7 was generally up-regulated in roots but down-regulated in shoots at the early stage of chilling stress.

Subcellular localization

  • OsPIP2;7 was localized mainly in mesophyll cells of leaves.
  • In roots OsPIP2;7 was detected in the vascular tissues, epidermis cells and exodermis cells at the elongation zone, as well as in the epidermis cells, exodermis cells and root hair at the maturation zone.

Labs working on this gene

  • Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences and Graduate School of the Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, PR China

References

  1. Li GW, Zhang MH, Cai WM, Sun WN, Su WA. Characterization of OsPIP2;7, a water channel protein in rice. Plant Cell Physiol. 2008 Dec;49(12):1851-8. doi: 10.1093/pcp/pcn166. PubMed PMID: 18988636.

Structured Information