Difference between revisions of "Os05g0423400"

From RiceWiki
Jump to: navigation, search
 
(9 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os05g0423400''''' was reported as '''''OsMADS4''''' in 2007 <ref name="ref1" /> by researchers from India.  
  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os05g0423400''''' '''''<=>''''' '''''OsMADS4'''''
 +
 
===Function===
 
===Function===
Please input function information here.
+
* The MADS-box family members, identified initially as floral homeotic genes, are one of the most extensively studied transcription factor genes in plants.
 +
* MADS-box genes have a variety of functions. In animals, MADS-box genes are involved in muscle development and cell proliferation and differentiation. Functions in fungi range from pheromone response to arginine metabolism.
 +
* MADS-box transcription factors, besides being involved in floral organ specification, have also been implicated in several aspects of plant growth and development.<ref name="ref1" /> <ref name="ref2" /> <ref name="ref3" />
  
===Expression===
+
===Evolution===
Please input expression information here.
+
* The MADS domain binds to DNA sequences of high similarity to the motif CC[A/T]6GG termed the CArG-box.
 +
* The MADS-box family has been divided into two main groups. The type I consists of ARG80/SRF-like genes of animals and fungi, also designated as M-type genes in plants, and type II contains MEF2-like genes of animals and yeast as well as MIKC-type genes of plants.
 +
* It is proposed that an ancestral duplication before the divergence of plants and animals gave rise to these groups
 +
* The length of the MADS-box reported by various researchers varies somewhat, but typical lengths are in the range of 168 to 180 base pairs, i.e. the encoded MADS domain has a length of 56 to 60 amino acids.
 +
* MADS-box genes seem to have evolved mainly through gene duplication events followed by neofunctionalization, subfunctionalization or in some cases pseudogenization of the duplicated gene.
 +
* However, redundancy being one of the fates of duplication is also common in MADS-box family.<ref name="ref1" /> <ref name="ref2" /> <ref name="ref3" />
  
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi 110 021, India
 +
* Division of Genetics, Indian Agricultural Research Institute, New Delhi-110 012, India
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Arora R, Agarwal P, Ray S, Singh AK, Singh VP, Tyagi AK, Kapoor S. MADS-box
 +
gene family in rice: genome-wide identification, organization and expression
 +
profiling during reproductive development and stress. BMC Genomics. 2007 Jul
 +
18;8:242. PubMed PMID: 17640358; PubMed Central PMCID: PMC1947970.
 +
 
 +
</ref>
 +
* <ref name="ref2">
 +
Shore P, Sharrocks AD. The MADS-box family of transcription factors. Eur J
 +
Biochem. 1995 Apr 1;229(1):1-13. Review. PubMed PMID: 7744019.
 +
</ref>
 +
 
 +
* <ref name="ref3">
 +
Winter KU, Becker A, M��nster T, Kim JT, Saedler H, Theissen G. MADS-box genes
 +
reveal that gnetophytes are more closely related to conifers than to flowering
 +
plants. Proc Natl Acad Sci U S A. 1999 Jun 22;96(13):7342-7. PubMed PMID:
 +
10377416; PubMed Central PMCID: PMC22087.
 +
 
 +
</ref>
 +
</references>
 +
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 5]]
GeneName = Os05g0423400|
 
Description = Similar to PISTILLATA-like MADS box protein|
 
Version = NM_001062125.1 GI:115463980 GeneID:4338842|
 
Length = 2303 bp|
 
Definition = Oryza sativa Japonica Group Os05g0423400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
 
AP = Chromosome 5:20766336..20768638|
 
CDS = 20766418..20766620,20766757..20766823,20766920..20766978,20767145..20767247,20767375..20767404<br>,20767517..20767561,20768202..20768342|
 
GCID = <gbrowseImage1>
 
name=NC_008398:20766336..20768638
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008398:20766336..20768638
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggggcgcggcaagatcgagatcaagaggatcgagaactcgacgaaccggcaggtgacgttctcgaagcgccgcgccgggatactcaagaaggcccgcgagatcggcgtgctctgcgacgccgaggtcggcgtcgtcatcttctccagcgccggcaagctctccgactactgcacgcccaagaccacgtccgtgtttcccccgctgtcaaggatcttggagaagtaccagaccaactccgggaagatactctgggatgagaagcacaagagcctcagcgcagagatcgatcgtgtcaagaaggagaacgacaacatgcagatcgagctcaggcatatgaaaggggaggatctgaactccctgcagcccaaggagctgatcgcgatcgaggaggcgctcaacaacggccaggccaatctgcgggacaagatgatggaccactggaggatgcataaaaggaatgagaagatgctggaggacgagcacaagatgttggcttttagggtgcaccagcaggaggtcgagctgagcggcggcataagggagctggagctcggctaccaccacgacgacagggacttcgcggcctcgatgccgttcaccttcagggtgcagcccagccaccccaacctccagcaggagaagtag</cdnaseq>|
 
AA = <aaseq>MGRGKIEIKRIENSTNRQVTFSKRRAGILKKAREIGVLCDAEVG                    VVIFSSAGKLSDYCTPKTTSVFPPLSRILEKYQTNSGKILWDEKHKSLSAEIDRVKKE                    NDNMQIELRHMKGEDLNSLQPKELIAIEEALNNGQANLRDKMMDHWRMHKRNEKMLED                    EHKMLAFRVHQQEVELSGGIRELELGYHHDDRDFAASMPFTFRVQPSHPNLQQEK</aaseq>|
 
DNA = <dnaseqindica>83..285#422..488#585..643#810..912#1040..1069#1182..1226#1867..2007#accctcttgtttcttcgagagcgaggtgaagatttgtttcttggtttgtgttcttggagtggaggaggaggaggagttggatatggggcgcggcaagatcgagatcaagaggatcgagaactcgacgaaccggcaggtgacgttctcgaagcgccgcgccgggatactcaagaaggcccgcgagatcggcgtgctctgcgacgccgaggtcggcgtcgtcatcttctccagcgccggcaagctctccgactactgcacgcccaagaccacgtccgtgtttcccccgtctctctctctcctcttccttgtttttttttcttttcttcttttcttgctcttaatttcagtgtttcctgagatatgcatgttctctttgcattgtgtttggcctttaatttgatttgtttttttggcgttttaggctgtcaaggatcttggagaagtaccagaccaactccgggaagatactctgggatgagaagcacaaggtgcgtgcttttctggattattttttttccaaacttttattcctacaaaatcgaatagaaatgcttaaaaaaatgtattcttggaaaacgtttcagagcctcagcgcagagatcgatcgtgtcaagaaggagaacgacaacatgcagatcgagctcaggctagtgtcccaacttattactatcatgcatctttatttctttcacttcctattaattaaagagacaactataaatcacccattgtagcgttttcagctttagattttgctcttgttggggacatcagggatggtggtgatttgtcaagcctgttccatgttgcaggcatatgaaaggggaggatctgaactccctgcagcccaaggagctgatcgcgatcgaggaggcgctcaacaacggccaggccaatctgcgggacaagatggtgattactgtctttgaagcttgatgtttacttcagcatggcatgcagagattgcaagtgccgcatctcttctttttcagagagagtttttgtttctgatgtcacctttgtttccatgatgttgcagatggaccactggaggatgcataaaaggaatgtatgagctctagatatctggatgattcttgtgcttcttttgtggatgatgaagtcaatatcttttgcaagctctgatcactcacctcacatgtctctgtgttcggcttcaggagaagatgctggaggacgagcacaagatgttggcttttagggtggtaatttccttcagagtaacttgtttttctattgaactttcacttgaaaaattccttgtgttctcatttctatttctaaaaaccatctgaaattgaggacaaataccatctgatataactgctctaactgttcaactaggttcgataataagtgacccttcgtagttgcgcctatcactactttagctatttttcagtgccatgctcattctaatgcggtcacttagatcactggtcaatattcaatcagaaccattctacgcaacaaatctctagactaactacccctgcattcagaattcatatagcgattgaaaattgaactccgtgcacggtagtagtagtagtcagatctattgtttctaatcaattgctatatggattcagaatgcaggtgtagtttgttcatatatgacaaaacatcctattgaatcttgaccagtgatctaattgactgctccattagatgttatcatctatgaacaaactacccctgcattctggatccatatagcaattgatcagaaatgccagatctgattactacttccctgcacagagctcaaacctcagtgagggaagctttactgaaagaagcctgaaagctgagagttcactgagctcctccccgtgttttcagcaccagcaggaggtcgagctgagcggcggcataagggagctggagctcggctaccaccacgacgacagggacttcgcggcctcgatgccgttcaccttcagggtgcagcccagccaccccaacctccagcaggagaagtaggctgctgagcactgccaatttggctgaacctcctgcttgctagctttgcatttcctcatgcgctgctagatgtatctgtggtttctctcatgcctgtctgaatgaactcacactgatgagagggtgtcagttgttttgtgctcctcccagcattagcactcagaattcagaaatgactcaatgtcagttgcttttgtgcttctcccagcattagcactcagaattcagaaatgactcaatgtcagttgcttttgtgcttctccctgcttgtttaattagccactgttcttgtttcc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062125.1 RefSeq:Os05g0423400]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 5]]
 
[[Category:Chromosome 5]]
 

Latest revision as of 02:14, 27 March 2017

The rice Os05g0423400 was reported as OsMADS4 in 2007 [1] by researchers from India.

Annotated Information

Gene Symbol

  • Os05g0423400 <=> OsMADS4

Function

  • The MADS-box family members, identified initially as floral homeotic genes, are one of the most extensively studied transcription factor genes in plants.
  • MADS-box genes have a variety of functions. In animals, MADS-box genes are involved in muscle development and cell proliferation and differentiation. Functions in fungi range from pheromone response to arginine metabolism.
  • MADS-box transcription factors, besides being involved in floral organ specification, have also been implicated in several aspects of plant growth and development.[1] [2] [3]

Evolution

  • The MADS domain binds to DNA sequences of high similarity to the motif CC[A/T]6GG termed the CArG-box.
  • The MADS-box family has been divided into two main groups. The type I consists of ARG80/SRF-like genes of animals and fungi, also designated as M-type genes in plants, and type II contains MEF2-like genes of animals and yeast as well as MIKC-type genes of plants.
  • It is proposed that an ancestral duplication before the divergence of plants and animals gave rise to these groups
  • The length of the MADS-box reported by various researchers varies somewhat, but typical lengths are in the range of 168 to 180 base pairs, i.e. the encoded MADS domain has a length of 56 to 60 amino acids.
  • MADS-box genes seem to have evolved mainly through gene duplication events followed by neofunctionalization, subfunctionalization or in some cases pseudogenization of the duplicated gene.
  • However, redundancy being one of the fates of duplication is also common in MADS-box family.[1] [2] [3]


You can also add sub-section(s) at will.

Labs working on this gene

  • Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi 110 021, India
  • Division of Genetics, Indian Agricultural Research Institute, New Delhi-110 012, India

References

  1. 1.0 1.1 1.2 Arora R, Agarwal P, Ray S, Singh AK, Singh VP, Tyagi AK, Kapoor S. MADS-box gene family in rice: genome-wide identification, organization and expression profiling during reproductive development and stress. BMC Genomics. 2007 Jul 18;8:242. PubMed PMID: 17640358; PubMed Central PMCID: PMC1947970.
  2. 2.0 2.1 Shore P, Sharrocks AD. The MADS-box family of transcription factors. Eur J Biochem. 1995 Apr 1;229(1):1-13. Review. PubMed PMID: 7744019.
  3. 3.0 3.1 Winter KU, Becker A, M��nster T, Kim JT, Saedler H, Theissen G. MADS-box genes reveal that gnetophytes are more closely related to conifers than to flowering plants. Proc Natl Acad Sci U S A. 1999 Jun 22;96(13):7342-7. PubMed PMID: 10377416; PubMed Central PMCID: PMC22087.


Structured Information