Difference between revisions of "Os02g0557500"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os02g0557500| Description = U2 auxiliary factor small subunit family protein| Version = NM_001053674.1 GI:115446718 GeneID:4329674| Length = 185...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os02g0557500''''' was reported as '''''OsC3H16''''' in 2012 <ref name="ref1" /> by researchers from China.
GeneName = Os02g0557500|
+
==Annotated Information==
Description = U2 auxiliary factor small subunit family protein|
+
===Gene Symbol===
Version = NM_001053674.1 GI:115446718 GeneID:4329674|
+
*'''''Os02g0557500''''' '''''<=>''''' '''''OsC3H16'''''
Length = 1857 bp|
+
===Function===
Definition = Oryza sativa Japonica Group Os02g0557500, complete gene.|
+
* Genes in the CCCH family encode zinc finger proteins containing the motif with three cysteines and one histidine residues.  <ref name="ref1" /> <ref name="ref2" />
Source = Oryza sativa Japonica Group
+
* CCCH-type zinc finger proteins have essential functions in various developmental processes in plants.
 +
* CCCH family genes have been known to play important roles in RNA processing as RNA-binding proteins.
 +
* CCCH-type zinc finger proteins are RNA-binding proteins by virtue of the ability of their defining motif to directly bind to RNA, whereas most of the other zinc finger families are confirmed as DNA-binding or protein-binding proteins.
 +
===Expression===
 +
* The expression profile indicated that most members of this subfamily are regulated by abiotic or biotic stresses, suggesting that they could have an effective role in stress tolerance.
 +
===Evolution===
 +
* A typical CCCH protein usually contains 1–6 CCCH-type zinc finger motifs.
 +
* Based on the different numbers of amino acid spacers between cysteines and histidines in the CCCH motif, a consensus sequence for these  was defined as C-X 4–15 -C-X 4–6 -C-X 3 -H (X represents any amino acid) based on the whole-genome analysis of rice and Arabidopsis CCCH proteins <ref name="ref1" /> <ref name="ref2" />
 +
You can also add sub-section(s) at will.
 +
==Labs working on this gene==
 +
* State Key Laboratory of Crop Biology, College of Life Sciences, Shandong Agricultural University, Taian, Shandong 271018, P.R. China
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Wang D, Guo Y, Wu C, Yang G, Li Y, Zheng C. Genome-wide analysis of CCCH zinc
 +
finger family in Arabidopsis and rice. BMC Genomics. 2008 Jan 27;9:44. doi:
 +
10.1186/1471-2164-9-44. PubMed PMID: 18221561; PubMed Central PMCID: PMC2267713.
 +
</ref>
 +
* <ref name="ref2">
 +
Peng X, Zhao Y, Cao J, Zhang W, Jiang H, Li X, Ma Q, Zhu S, Cheng B. CCCH-type
 +
zinc finger family in maize: genome-wide identification, classification and
 +
expression profiling under abscisic acid and drought treatments. PLoS One.
 +
2012;7(7):e40120. doi: 10.1371/journal.pone.0040120. PubMed PMID: 22792223;
 +
PubMed Central PMCID: PMC3391233.
 +
</ref>
 +
</references>
  
  ORGANISM  Oryza sativa Japonica Group
+
==Structured Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:21971844..21973700|
 
CDS = 21971876..21971905,21972091..21972165,21972346..21972572,21972668..21973541|
 
GCID = <gbrowseImage1>
 
name=NC_008395:21971844..21973700
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:21971844..21973700
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgaatggacggtattttgctgggaagcagataacatgtgaatttgttgctgtgacaagatggaaggttgccatatgtggtgaatacatgaggtcaagattcaagacatgttcacgtggaatcgcttgtaattttattcattgctttcgcaaccctggaggagattatgagtgggctgattgggataatcctcctcctagatactggattaggaagatggctgctctttttggtccctcggatgattctatctatggcaagccaagcgacaccccacatttagagcgctcacagagttcagacaggaggagaccgagaagttctgatcctaggtacacaccaagcagaacaagggatgaagatgcacataaacagcactcgtccagagattattcacattcgaagcatgaacgcagcagccatactgagcacagacgagacagaaaagaatcatctgcatcagataagcaccgacatcgagagattaaagataagaccagcaaatactcctctaacatggaaagtgaaagagagtcccacaagtacatgcgtgaagaaaaacataggattgaccatggaaatggaggtaaaggagaccatggtaaagttaggtcgaggaagaacagatctgaacgccaagaaagtttggagcctggatcttctggccggtcttcggacttcatcgatcaagacaccaccgagagtccttcaggcagcaagtccactggcaggcatcacaagaagaccaggaggcaatccttagaagagcacagcaccagaaggagctcaaggcatcgggacatggaagatgatggaagaggacagtctgtagctgtaaaacgcaaggatcaccatgatacatcggatgatagatgggtagcaacaaacagtgatgttgattcagacttggagactcaataccagaggtcaagtagtgaaggcagcaagctgggaatgaaatatcatgctcgatcagattcagaaactgggtacggaaggtcaagaagtggaacaaccaagagccgtagggaaaggaagcgtcagagtggaaacggtgagcgcagcgacactttagaggttacttcagattcagacaccagagatatgagctctgatgcatggaggagccgatcgagaagcagtgacgagaatctctcaacgcacaggtcaaggagaaaaagaagtcgcagtagtcatgattcctga</cdnaseq>|
 
AA = <aaseq>MNGRYFAGKQITCEFVAVTRWKVAICGEYMRSRFKTCSRGIACN                    FIHCFRNPGGDYEWADWDNPPPRYWIRKMAALFGPSDDSIYGKPSDTPHLERSQSSDR                    RRPRSSDPRYTPSRTRDEDAHKQHSSRDYSHSKHERSSHTEHRRDRKESSASDKHRHR                    EIKDKTSKYSSNMESERESHKYMREEKHRIDHGNGGKGDHGKVRSRKNRSERQESLEP                    GSSGRSSDFIDQDTTESPSGSKSTGRHHKKTRRQSLEEHSTRRSSRHRDMEDDGRGQS                    VAVKRKDHHDTSDDRWVATNSDVDSDLETQYQRSSSEGSKLGMKYHARSDSETGYGRS                    RSGTTKSRRERKRQSGNGERSDTLEVTSDSDTRDMSSDAWRSRSRSSDENLSTHRSRR                    KRSRSSHDS</aaseq>|
 
DNA = <dnaseqindica>33..62#248..322#503..729#825..1698#cattggattcagctcttattgcctacagcagcatgaatggacggtattttgctgggaagcaggtaattgttttaattcattcctcaaaggactgtcagttttgagcacagttggtacattgagaagcattgttgttaatcctctatgtctcagataatcctacactatcatattgtgctgtcaaataggtttgtttccatttgcttctctttcatggtctgaaattggaatttttttcctcgtacagataacatgtgaatttgttgctgtgacaagatggaaggttgccatatgtggtgaatacatgaggtcaagattcaaggtaccctaaaggctgaaactacagctgtctcctttactcagttgctcttggttttatttatcatatgtaggaagcatgtccacagtattgatatttgccagaggaactctctctcgagattttagcttagaatgtgatatcatctgtgtgtttttcattttctcctctcctgtttaacagacatgttcacgtggaatcgcttgtaattttattcattgctttcgcaaccctggaggagattatgagtgggctgattgggataatcctcctcctagatactggattaggaagatggctgctctttttggtccctcggatgattctatctatggcaagccaagcgacaccccacatttagagcgctcacagagttcagacaggaggagaccgagaagttctgatcctaggtacatgctacttatctgttaatcattttctttgtagagttttaatatgaatgtctagaccgagatatgctaatagcatatttttaattcaataggtacacaccaagcagaacaagggatgaagatgcacataaacagcactcgtccagagattattcacattcgaagcatgaacgcagcagccatactgagcacagacgagacagaaaagaatcatctgcatcagataagcaccgacatcgagagattaaagataagaccagcaaatactcctctaacatggaaagtgaaagagagtcccacaagtacatgcgtgaagaaaaacataggattgaccatggaaatggaggtaaaggagaccatggtaaagttaggtcgaggaagaacagatctgaacgccaagaaagtttggagcctggatcttctggccggtcttcggacttcatcgatcaagacaccaccgagagtccttcaggcagcaagtccactggcaggcatcacaagaagaccaggaggcaatccttagaagagcacagcaccagaaggagctcaaggcatcgggacatggaagatgatggaagaggacagtctgtagctgtaaaacgcaaggatcaccatgatacatcggatgatagatgggtagcaacaaacagtgatgttgattcagacttggagactcaataccagaggtcaagtagtgaaggcagcaagctgggaatgaaatatcatgctcgatcagattcagaaactgggtacggaaggtcaagaagtggaacaaccaagagccgtagggaaaggaagcgtcagagtggaaacggtgagcgcagcgacactttagaggttacttcagattcagacaccagagatatgagctctgatgcatggaggagccgatcgagaagcagtgacgagaatctctcaacgcacaggtcaaggagaaaaagaagtcgcagtagtcatgattcctgatgccattggcacgatttcttcgaagcttctcatcatctgaacactacagttgccaactttggtttgtggattatttagctagcttatgtaatagcatgttgcaaggccaaatatatttttggttcgtcttttacctaagaagagtaatttttctcttcc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053674.1 RefSeq:Os02g0557500]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 03:47, 28 March 2017

The rice Os02g0557500 was reported as OsC3H16 in 2012 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os02g0557500 <=> OsC3H16

Function

  • Genes in the CCCH family encode zinc finger proteins containing the motif with three cysteines and one histidine residues. [1] [2]
  • CCCH-type zinc finger proteins have essential functions in various developmental processes in plants.
  • CCCH family genes have been known to play important roles in RNA processing as RNA-binding proteins.
  • CCCH-type zinc finger proteins are RNA-binding proteins by virtue of the ability of their defining motif to directly bind to RNA, whereas most of the other zinc finger families are confirmed as DNA-binding or protein-binding proteins.

Expression

  • The expression profile indicated that most members of this subfamily are regulated by abiotic or biotic stresses, suggesting that they could have an effective role in stress tolerance.

Evolution

  • A typical CCCH protein usually contains 1–6 CCCH-type zinc finger motifs.
  • Based on the different numbers of amino acid spacers between cysteines and histidines in the CCCH motif, a consensus sequence for these was defined as C-X 4–15 -C-X 4–6 -C-X 3 -H (X represents any amino acid) based on the whole-genome analysis of rice and Arabidopsis CCCH proteins [1] [2]

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Crop Biology, College of Life Sciences, Shandong Agricultural University, Taian, Shandong 271018, P.R. China

References

  1. 1.0 1.1 1.2 Wang D, Guo Y, Wu C, Yang G, Li Y, Zheng C. Genome-wide analysis of CCCH zinc finger family in Arabidopsis and rice. BMC Genomics. 2008 Jan 27;9:44. doi: 10.1186/1471-2164-9-44. PubMed PMID: 18221561; PubMed Central PMCID: PMC2267713.
  2. 2.0 2.1 Peng X, Zhao Y, Cao J, Zhang W, Jiang H, Li X, Ma Q, Zhu S, Cheng B. CCCH-type zinc finger family in maize: genome-wide identification, classification and expression profiling under abscisic acid and drought treatments. PLoS One. 2012;7(7):e40120. doi: 10.1371/journal.pone.0040120. PubMed PMID: 22792223; PubMed Central PMCID: PMC3391233.

Structured Information