Difference between revisions of "Os07g0138400"

From RiceWiki
Jump to: navigation, search
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os07g0138400''''' was reported as '''''OsC3H47''''' in 2012 <ref name="ref1" /> by researchers from China.  
 
 
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os07g0138400''''' '''''<=>''''' '''''OsC3H47'''''
 
===Function===
 
===Function===
Please input function information here.
+
* Genes in the CCCH family encode zinc finger proteins containing the motif with three cysteines and one histidine residues. <ref name="ref1" /> <ref name="ref2" />
 
+
* CCCH-type zinc finger proteins have essential functions in various developmental processes in plants.
 +
* CCCH family genes have been known to play important roles in RNA processing as RNA-binding proteins.
 +
* CCCH-type zinc finger proteins are RNA-binding proteins by virtue of the ability of their defining motif to directly bind to RNA, whereas most of the other zinc finger families are confirmed as DNA-binding or protein-binding proteins.
 
===Expression===
 
===Expression===
Please input expression information here.
+
* The expression profile indicated that most members of this subfamily are regulated by abiotic or biotic stresses, suggesting that they could have an effective role in stress tolerance.
 
 
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
* A typical CCCH protein usually contains 1–6 CCCH-type zinc finger motifs.  
 
+
* Based on the different numbers of amino acid spacers between cysteines and histidines in the CCCH motif, a consensus sequence for these  was defined as C-X 4–15 -C-X 4–6 -C-X 3 -H (X represents any amino acid) based on the whole-genome analysis of rice and Arabidopsis CCCH proteins <ref name="ref1" /> <ref name="ref2" />
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* State Key Laboratory of Crop Biology, College of Life Sciences, Shandong Agricultural University, Taian, Shandong 271018, P.R. China
 
 
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Wang D, Guo Y, Wu C, Yang G, Li Y, Zheng C. Genome-wide analysis of CCCH zinc
 +
finger family in Arabidopsis and rice. BMC Genomics. 2008 Jan 27;9:44. doi:
 +
10.1186/1471-2164-9-44. PubMed PMID: 18221561; PubMed Central PMCID: PMC2267713.
 +
</ref>
 +
* <ref name="ref2">
 +
Peng X, Zhao Y, Cao J, Zhang W, Jiang H, Li X, Ma Q, Zhu S, Cheng B. CCCH-type
 +
zinc finger family in maize: genome-wide identification, classification and
 +
expression profiling under abscisic acid and drought treatments. PLoS One.
 +
2012;7(7):e40120. doi: 10.1371/journal.pone.0040120. PubMed PMID: 22792223;
 +
PubMed Central PMCID: PMC3391233.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 7]]
GeneName = Os07g0138400|
 
Description = Conserved hypothetical protein|
 
Version = NM_001188122.1 GI:297725374 GeneID:9266125|
 
Length = 1571 bp|
 
Definition = Oryza sativa Japonica Group Os07g0138400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
 
AP = Chromosome 7:2067324..2068894|
 
CDS = 2067602..2067793|
 
GCID = <gbrowseImage1>
 
name=NC_008400:2067324..2068894
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008400:2067324..2068894
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>gagtcggcggcgggggacgtccgtgcccggagctcgccgccgccaagggatggtgcaggtacgggctcaactgcaagtattgccatggcggcgtataggatcgaggagcagcgccatgggaggggggagtccttcatcttacaacgctcgcggaggaaacacgtcaggttagagtctggatcatatgactga</cdnaseq>|
 
AA = <aaseq>ESAAGDVRARSSPPPRDGAGTGSTASIAMAAYRIEEQRHGRGES                    FILQRSRRKHVRLESGSYD</aaseq>|
 
DNA = <dnaseqindica>1102..1293#acacgcctcgcctcgcctcgccctccatcgagatggccgatcccaacggccgccgccgcctccccaccggtgatccagatcaagccaacgcctccccgtcccggcgagtctccgccgtcgatggcgtcaccggcggcgagggcaggcccacctactcccacttcccccccggcgcgtacgagccgacggacgtggcctacggcatccgcgacgcggccaacgacgagcgggcgcgggcgcgggctcgggctcgccatgaccagggtggcggggctcatgaccaccaccacgaccggccccggcaagaccagcgcggcgaggctcacctccacgacctccccggcgagaagagcgaggtccccgacgtcggtccatctgaccaacaggggaaggaagcctccgacaccgacatggctccattggcggcgctggcaaagagatcctacgacgtcaacttcccgccgctgcacgagcaccgcgccgcccccttccccgccccggcacccgcattcgcacccgcaccggcgggcaccatgggatcctcttccgcacaggtgcagggtgacggggctcctgacaatcacgaccacgacccacgtcacctaccccggcaagaccagagcggcggagctcaccccgacgacctccacggcgagaagaccatcggttcaggctccgatatcctcgacgactccaagagaggaatgatcaacgccggtccccaacacggccgcatcaccacctccaatggcggcagcggcagcggcagcgacaagggcaagggggtctcctacgccggggacaagcccgcatctagctcgtcgtcctccagctctgctggccagcaggggagcgacaccgacaaaactccttcggcggcggcggcgagctcctacgccgtcaacttcccgccgctgctgcccgcacccgctcccgtccccgcccccgcacccgcacccgcggtcgccggcgccatgggtgttgccaatgcccaccacaagattgcgctgtgcagcaagtggaggaaggggaggtgccacaacggggcagcgtgtcgctactctcatggcgaggaggagcaacgaattgtgccggagatgagagtcggcggcgggggacgtccgtgcccggagctcgccgccgccaagggatggtgcaggtacgggctcaactgcaagtattgccatggcggcgtataggatcgaggagcagcgccatgggaggggggagtccttcatcttacaacgctcgcggaggaaacacgtcaggttagagtctggatcatatgactgaatccatccgaatcatctggtcagctgttttgcttctgttgtggtcagatgaaccactgcgttttttgttgctagatcgagtctactctagtcatgcgtttgatttgattcgactcgtgaatccatccgaatctgaattcgaccaaggaccagtacactttttgtttcttttttggtcagatgaaccactgcgagttttcgttgtcagggtctaggggaaaaagattactagaacccatgaatttgattttgagtcctaataaacttgatgcagtgatg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001188122.1 RefSeq:Os07g0138400]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 7]]
 
[[Category:Chromosome 7]]
 

Latest revision as of 04:00, 28 March 2017

The rice Os07g0138400 was reported as OsC3H47 in 2012 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os07g0138400 <=> OsC3H47

Function

  • Genes in the CCCH family encode zinc finger proteins containing the motif with three cysteines and one histidine residues. [1] [2]
  • CCCH-type zinc finger proteins have essential functions in various developmental processes in plants.
  • CCCH family genes have been known to play important roles in RNA processing as RNA-binding proteins.
  • CCCH-type zinc finger proteins are RNA-binding proteins by virtue of the ability of their defining motif to directly bind to RNA, whereas most of the other zinc finger families are confirmed as DNA-binding or protein-binding proteins.

Expression

  • The expression profile indicated that most members of this subfamily are regulated by abiotic or biotic stresses, suggesting that they could have an effective role in stress tolerance.

Evolution

  • A typical CCCH protein usually contains 1–6 CCCH-type zinc finger motifs.
  • Based on the different numbers of amino acid spacers between cysteines and histidines in the CCCH motif, a consensus sequence for these was defined as C-X 4–15 -C-X 4–6 -C-X 3 -H (X represents any amino acid) based on the whole-genome analysis of rice and Arabidopsis CCCH proteins [1] [2]

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Crop Biology, College of Life Sciences, Shandong Agricultural University, Taian, Shandong 271018, P.R. China

References

  1. 1.0 1.1 1.2 Wang D, Guo Y, Wu C, Yang G, Li Y, Zheng C. Genome-wide analysis of CCCH zinc finger family in Arabidopsis and rice. BMC Genomics. 2008 Jan 27;9:44. doi: 10.1186/1471-2164-9-44. PubMed PMID: 18221561; PubMed Central PMCID: PMC2267713.
  2. 2.0 2.1 Peng X, Zhao Y, Cao J, Zhang W, Jiang H, Li X, Ma Q, Zhu S, Cheng B. CCCH-type zinc finger family in maize: genome-wide identification, classification and expression profiling under abscisic acid and drought treatments. PLoS One. 2012;7(7):e40120. doi: 10.1371/journal.pone.0040120. PubMed PMID: 22792223; PubMed Central PMCID: PMC3391233.

Structured Information