Difference between revisions of "Os07g0114000"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os07g0114000| Description = Similar to Protein phosphatase 2C-like| Version = NM_001065285.1 GI:115470302 GeneID:4342246| Length = 1567 bp| Def...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os07g0114000''''' was reported as '''''OsPP2C61''''' in 2008 <ref name="ref1" /> by researchers from China.
GeneName = Os07g0114000|
+
==Annotated Information==
Description = Similar to Protein phosphatase 2C-like|
+
===Gene Symbol===
Version = NM_001065285.1 GI:115470302 GeneID:4342246|
+
*'''''Os07g0114000''''' '''''<=>''''' '''''OsPP2C61'''''
Length = 1567 bp|
+
===Function===
Definition = Oryza sativa Japonica Group Os07g0114000, complete gene.|
+
* The protein phosphatase 2Cs (PP2Cs) from various organisms have been implicated to act as negative modulators of protein kinase pathways involved in diverse environmental stress responses and developmental processes.<ref name="ref1" />  
Source = Oryza sativa Japonica Group
+
* Type 2C protein phosphatases directly regulate abscisic acid-activated protein kinases in Arabidopsis.<ref name="ref1" /> <ref name="ref2" />  
 
+
===Expression===
  ORGANISM  Oryza sativa Japonica Group
+
* The expression analyses from the researchers provide evidences that PP2C genes in different subfamilies might play different functional roles in distinct signaling pathways.<ref name="ref1" />  
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
===Knowledge extension===
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
* The reversible phosphorylation of proteins is a fundamental mechanism by which living organisms modulate cellular processes including cell cycle events, growth factor responses, hormone and environmental stimuli responses, metabolic control, and developmental processes.<ref name="ref1" />  
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
You can also add sub-section(s) at will.
|
+
==Labs working on this gene==
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
+
* State Key Laboratory of Crop Biology, College of Life Sciences, Shandong Agricultural University, Taian, Shandong 271018, PR China
AP = Chromosome 7:779384..780950|
+
* Biology Department, Millersville University of Pennsylvania, 288 Roddy Hall, 50 E Frederick St, PO Box 1002, Millersville PA, 17551-0302, USA
CDS = 779554..780434,780542..780794|
+
* Department of Chemistry, Fudan University, 220 Handan Road, Shanghai 200433, PR China
GCID = <gbrowseImage1>
+
* Institutes of Biomedical Sciences, Fudan University, 130 Dongan Road, Shanghai 200032, PR China
name=NC_008400:779384..780950
+
* Centre for Forest Biology & Department of Biology, University of Victoria, Victoria BC, V8W 3N5, Canada
source=RiceChromosome07
+
==References==
preset=GeneLocation
+
<references>
</gbrowseImage1>|
+
* <ref name="ref1">
GSID = <gbrowseImage2>
+
Xue T, Wang D, Zhang S, Ehlting J, Ni F, Jakab S, Zheng C, Zhong Y.
name=NC_008400:779384..780950
+
Genome-wide and expression analysis of protein phosphatase 2C in rice and
source=RiceChromosome07
+
Arabidopsis. BMC Genomics. 2008 Nov 20;9:550. doi: 10.1186/1471-2164-9-550.
preset=GeneLocation
+
PubMed PMID: 19021904; PubMed Central PMCID: PMC2612031.
</gbrowseImage2>|
+
</ref>
CDNA = <cdnaseq>atgatggcgaggtggtgcgtggggtggccggcggcggcgaggggtggtcgggatgagctgacgtggcaggcggagctgacggcgcacgcggcgggggagttctccatggcggcggcgcaggccaacgcggtgatggaggaccaggcgcaggtcatggcgtcgcccggcgccacgctcgtcggcgtctatgatggccatggcggccccgacgcctcccgcttcctccgctcccgcctattccctctcatccatgagttcgcggcggagcgcggcggcgcggtggacgccgacgtgatccggaaggcgttcctggcggccgacgaggagtacctccagctgctgcggtggtcgctgccgaacatgtcccgcgcggccgcctcgggctcctgctgcctcctgggcgccatctccggcgacacgctctacgtcgccaacgccggcgactcccgcgctgtcctcggccgccgcgcggcggccggccagaccgtcgccgagcggctctccaccgagcacaacgtggcctcggaggaggtccggagggagctcgccgcgctccaccccgacgacggcgaggtcgtggtccacgcccgcggcgcgtggagggtgaaggggatcatccaggtggcgcgcgccatcggcgacgtgtacctcaagacgccggagttcaagcgcgacccggcggtgcagcggctatgcagcgccgccgccgccgtcgagctggcgcggccggtggtcaccgccgagccgtccatccacgcccggaagctcaaggcgggcgtcgacctgttcgtcgtgttcgcctccgacggcctatgggagcacctctccgacgaggcggcggtgcagctggtgtccaagagctcgacgaggagaggcgtggcggcgaggctggtgcaggcagcgctcggggaggcggcgaggaagcgggaggtgaggcgcggcgacctgcggcggatcgagcgaggggtgaggcgccacttccacgacgacatcaccgccgtcgtcgtcttcctcgacctcgacgacgacggcggccgccgcgcgcgccgccgtggcagggtcgtcgactccagcagcagcagctgcagcaacacgccgctcgacgtctacagcttgtacaactccaccgcttga</cdnaseq>|
+
* <ref name="ref2">
AA = <aaseq>MMARWCVGWPAAARGGRDELTWQAELTAHAAGEFSMAAAQANAV                    MEDQAQVMASPGATLVGVYDGHGGPDASRFLRSRLFPLIHEFAAERGGAVDADVIRKA                    FLAADEEYLQLLRWSLPNMSRAAASGSCCLLGAISGDTLYVANAGDSRAVLGRRAAAG                    QTVAERLSTEHNVASEEVRRELAALHPDDGEVVVHARGAWRVKGIIQVARAIGDVYLK                    TPEFKRDPAVQRLCSAAAAVELARPVVTAEPSIHARKLKAGVDLFVVFASDGLWEHLS                    DEAAVQLVSKSSTRRGVAARLVQAALGEAARKREVRRGDLRRIERGVRRHFHDDITAV                    VVFLDLDDDGGRRARRRGRVVDSSSSSCSNTPLDVYSLYNSTA</aaseq>|
+
Umezawa T, Sugiyama N, Mizoguchi M, Hayashi S, Myouga F, Yamaguchi-Shinozaki
DNA = <dnaseqindica>517..1397#157..409#acgtcgcctcgccggagaagaagacatcgccaacatataccccccctccctacctagactcagatcagatcacctgcccatcgacgagcacaagagcgatccattcctggtttgaatcgagcttggtttgtttggttggttggtttcttggagtggatgatggcgaggtggtgcgtggggtggccggcggcggcgaggggtggtcgggatgagctgacgtggcaggcggagctgacggcgcacgcggcgggggagttctccatggcggcggcgcaggccaacgcggtgatggaggaccaggcgcaggtcatggcgtcgcccggcgccacgctcgtcggcgtctatgatggccatggcggccccgacgcctcccgcttcctccgctcccgcctattccctctcatccatggtgcgtgcgctcgccggcgcgcggcggagctcgatcttgtggtttgatttgaatacgttggcaagaatctttagctgattttgttggcgccaaaaattgatgagcagagttcgcggcggagcgcggcggcgcggtggacgccgacgtgatccggaaggcgttcctggcggccgacgaggagtacctccagctgctgcggtggtcgctgccgaacatgtcccgcgcggccgcctcgggctcctgctgcctcctgggcgccatctccggcgacacgctctacgtcgccaacgccggcgactcccgcgctgtcctcggccgccgcgcggcggccggccagaccgtcgccgagcggctctccaccgagcacaacgtggcctcggaggaggtccggagggagctcgccgcgctccaccccgacgacggcgaggtcgtggtccacgcccgcggcgcgtggagggtgaaggggatcatccaggtggcgcgcgccatcggcgacgtgtacctcaagacgccggagttcaagcgcgacccggcggtgcagcggctatgcagcgccgccgccgccgtcgagctggcgcggccggtggtcaccgccgagccgtccatccacgcccggaagctcaaggcgggcgtcgacctgttcgtcgtgttcgcctccgacggcctatgggagcacctctccgacgaggcggcggtgcagctggtgtccaagagctcgacgaggagaggcgtggcggcgaggctggtgcaggcagcgctcggggaggcggcgaggaagcgggaggtgaggcgcggcgacctgcggcggatcgagcgaggggtgaggcgccacttccacgacgacatcaccgccgtcgtcgtcttcctcgacctcgacgacgacggcggccgccgcgcgcgccgccgtggcagggtcgtcgactccagcagcagcagctgcagcaacacgccgctcgacgtctacagcttgtacaactccaccgcttgaacaacaatatatttaatatttgggatttcccatgtcatgttgcttacaactacattttttttaaacatttttacaaataggatgtcgagttaggttaacacttaggatctgtttgtcatagtttaactctatcttttttgaagttggagttcagactaacagttttaggt</dnaseqindica>|
+
K, Ishihama Y, Hirayama T, Shinozaki K. Type 2C protein phosphatases directly
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001065285.1 RefSeq:Os07g0114000]|
+
regulate abscisic acid-activated protein kinases in Arabidopsis. Proc Natl Acad
}}
+
Sci U S A. 2009 Oct 13;106(41):17588-93. doi: 10.1073/pnas.0907095106. Epub 2009
[[Category:Genes]]
+
Sep 29. PubMed PMID: 19805022; PubMed Central PMCID: PMC2754379.
[[Category:Japonica mRNA]]
+
</ref>
[[Category:Oryza Sativa Japonica Group]]
+
</references>
[[Category:Japonica Genes]]
+
==Structured Information==
[[Category:Japonica Chromosome 7]]
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 7]]
[[Category:Chromosome 7]]
 

Latest revision as of 11:59, 29 March 2017

The rice Os07g0114000 was reported as OsPP2C61 in 2008 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os07g0114000 <=> OsPP2C61

Function

  • The protein phosphatase 2Cs (PP2Cs) from various organisms have been implicated to act as negative modulators of protein kinase pathways involved in diverse environmental stress responses and developmental processes.[1]
  • Type 2C protein phosphatases directly regulate abscisic acid-activated protein kinases in Arabidopsis.[1] [2]

Expression

  • The expression analyses from the researchers provide evidences that PP2C genes in different subfamilies might play different functional roles in distinct signaling pathways.[1]

Knowledge extension

  • The reversible phosphorylation of proteins is a fundamental mechanism by which living organisms modulate cellular processes including cell cycle events, growth factor responses, hormone and environmental stimuli responses, metabolic control, and developmental processes.[1]

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Crop Biology, College of Life Sciences, Shandong Agricultural University, Taian, Shandong 271018, PR China
  • Biology Department, Millersville University of Pennsylvania, 288 Roddy Hall, 50 E Frederick St, PO Box 1002, Millersville PA, 17551-0302, USA
  • Department of Chemistry, Fudan University, 220 Handan Road, Shanghai 200433, PR China
  • Institutes of Biomedical Sciences, Fudan University, 130 Dongan Road, Shanghai 200032, PR China
  • Centre for Forest Biology & Department of Biology, University of Victoria, Victoria BC, V8W 3N5, Canada

References

  1. 1.0 1.1 1.2 1.3 1.4 Xue T, Wang D, Zhang S, Ehlting J, Ni F, Jakab S, Zheng C, Zhong Y. Genome-wide and expression analysis of protein phosphatase 2C in rice and Arabidopsis. BMC Genomics. 2008 Nov 20;9:550. doi: 10.1186/1471-2164-9-550. PubMed PMID: 19021904; PubMed Central PMCID: PMC2612031.
  2. Umezawa T, Sugiyama N, Mizoguchi M, Hayashi S, Myouga F, Yamaguchi-Shinozaki K, Ishihama Y, Hirayama T, Shinozaki K. Type 2C protein phosphatases directly regulate abscisic acid-activated protein kinases in Arabidopsis. Proc Natl Acad Sci U S A. 2009 Oct 13;106(41):17588-93. doi: 10.1073/pnas.0907095106. Epub 2009 Sep 29. PubMed PMID: 19805022; PubMed Central PMCID: PMC2754379.

Structured Information