Difference between revisions of "Os09g0325700"

From RiceWiki
Jump to: navigation, search
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os09g0325700''''' was reported as '''''OsPP2C68''''' in 2008 <ref name="ref1" /> by researchers from China.  
 
 
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os09g0325700''''' '''''<=>''''' '''''OsPP2C68'''''
 
===Function===
 
===Function===
Please input function information here.
+
* The protein phosphatase 2Cs (PP2Cs) from various organisms have been implicated to act as negative modulators of protein kinase pathways involved in diverse environmental stress responses and developmental processes.<ref name="ref1" />
 
+
* Type 2C protein phosphatases directly regulate abscisic acid-activated protein kinases in Arabidopsis.<ref name="ref1" /> <ref name="ref2" />
 
===Expression===
 
===Expression===
Please input expression information here.
+
* The expression analyses from the researchers provide evidences that PP2C genes in different subfamilies might play different functional roles in distinct signaling pathways.<ref name="ref1" />
 
+
===Knowledge extension===
===Evolution===
+
* The reversible phosphorylation of proteins is a fundamental mechanism by which living organisms modulate cellular processes including cell cycle events, growth factor responses, hormone and environmental stimuli responses, metabolic control, and developmental processes.<ref name="ref1" />
Please input evolution information here.
 
 
 
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* State Key Laboratory of Crop Biology, College of Life Sciences, Shandong Agricultural University, Taian, Shandong 271018, PR China
 
+
* Biology Department, Millersville University of Pennsylvania, 288 Roddy Hall, 50 E Frederick St, PO Box 1002, Millersville PA, 17551-0302, USA
 +
* Department of Chemistry, Fudan University, 220 Handan Road, Shanghai 200433, PR China
 +
* Institutes of Biomedical Sciences, Fudan University, 130 Dongan Road, Shanghai 200032, PR China
 +
* Centre for Forest Biology & Department of Biology, University of Victoria, Victoria BC, V8W 3N5, Canada
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Xue T, Wang D, Zhang S, Ehlting J, Ni F, Jakab S, Zheng C, Zhong Y.
 +
Genome-wide and expression analysis of protein phosphatase 2C in rice and
 +
Arabidopsis. BMC Genomics. 2008 Nov 20;9:550. doi: 10.1186/1471-2164-9-550.
 +
PubMed PMID: 19021904; PubMed Central PMCID: PMC2612031.
 +
</ref>
 +
* <ref name="ref2">
 +
Umezawa T, Sugiyama N, Mizoguchi M, Hayashi S, Myouga F, Yamaguchi-Shinozaki
 +
K, Ishihama Y, Hirayama T, Shinozaki K. Type 2C protein phosphatases directly
 +
regulate abscisic acid-activated protein kinases in Arabidopsis. Proc Natl Acad
 +
Sci U S A. 2009 Oct 13;106(41):17588-93. doi: 10.1073/pnas.0907095106. Epub 2009
 +
Sep 29. PubMed PMID: 19805022; PubMed Central PMCID: PMC2754379.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 9]]
GeneName = Os09g0325700|
 
Description = Similar to Protein phpsphatase 2C (PP2C) (EC 3.1.3.16)|
 
Version = NM_001069416.1 GI:115478574 GeneID:4346736|
 
Length = 1407 bp|
 
Definition = Oryza sativa Japonica Group Os09g0325700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:10133182..10134588|
 
CDS = 10133262..10134338|
 
GCID = <gbrowseImage1>
 
name=NC_008402:10133182..10134588
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:10133182..10134588
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtcgatggcggaggtgtgctgtgattctgcggtggtggtcggggcggaggcggaggcgagggcgagggcgcgcgccgggaggcggcggcgggcgggagttgagggggcagggaggtggaacgccacggcgacggctgcgggtgtggcggcggaggaggccgcgacgaggaagcggagggcgagtggtggtgaggccgggttggtggtggtggcgaagcggcacggggcggcgtcggtcgccgggaggaggagggagatggaggacgccgtgtcgctgcgcgaggcgttcgccgcgccggcgaacggggaggttgcggcggcgaggtgtgacttctacggggtgttcgacgggcacggctgctcgcacgtggcggacgcgtgcagggagcggatgcacgagctcgtcgcggaggagatgggcgccgggtcaccggcggcggcggcgcgcgagccggcgtcttggacggagacgatggagcggagcttcgcgaggatggacgccgaggtgatcgccggctgccgagccgagagcggcagctgccggtgcgaggggcagaagtgcgaccacgtggggtccaccgcggtggtggccgtcgtggaggagagccgcgtcgtcgtcgccaactgcggcgactcccgcgccgtgctctgccgcggcggcgcgcccgtgcagctatcctccgaccacaagcccgaccgccccgacgagctggagcggatcgaggcggccggcggccgcgtcatcttctgggagggcgcccgtgtcctcggcgtcctcgccatgtcgcgctccatcggcgacgcctacctgaagccctacgtcaccgccgtgccggaggtgacggtgaccggcaggtcggacttcgacgagtgcctcatcctcgccagcgacggcctctgggacgtcgtcagcaacgaggccgcgtgcgaggtggcgcagtcgtgcctccgccgcggcaggcagcggtggtgcgccgaggcggcggcggtgctgaccaagctggccctcgctcgccgcagctccgacaacatctctgtcgtcgtcgtcgatctccggcgaggcaacgccttgtag</cdnaseq>|
 
AA = <aaseq>MSMAEVCCDSAVVVGAEAEARARARAGRRRRAGVEGAGRWNATA                    TAAGVAAEEAATRKRRASGGEAGLVVVAKRHGAASVAGRRREMEDAVSLREAFAAPAN                    GEVAAARCDFYGVFDGHGCSHVADACRERMHELVAEEMGAGSPAAAAREPASWTETME                    RSFARMDAEVIAGCRAESGSCRCEGQKCDHVGSTAVVAVVEESRVVVANCGDSRAVLC                    RGGAPVQLSSDHKPDRPDELERIEAAGGRVIFWEGARVLGVLAMSRSIGDAYLKPYVT                    AVPEVTVTGRSDFDECLILASDGLWDVVSNEAACEVAQSCLRRGRQRWCAEAAAVLTK                    LALARRSSDNISVVVVDLRRGNAL</aaseq>|
 
DNA = <dnaseqindica>81..1157#attctctctctcgttgctcctgagatcgtctcgtctcgtggtggtggtggtggccattgccggagcttccaaggtgtttgatgtcgatggcggaggtgtgctgtgattctgcggtggtggtcggggcggaggcggaggcgagggcgagggcgcgcgccgggaggcggcggcgggcgggagttgagggggcagggaggtggaacgccacggcgacggctgcgggtgtggcggcggaggaggccgcgacgaggaagcggagggcgagtggtggtgaggccgggttggtggtggtggcgaagcggcacggggcggcgtcggtcgccgggaggaggagggagatggaggacgccgtgtcgctgcgcgaggcgttcgccgcgccggcgaacggggaggttgcggcggcgaggtgtgacttctacggggtgttcgacgggcacggctgctcgcacgtggcggacgcgtgcagggagcggatgcacgagctcgtcgcggaggagatgggcgccgggtcaccggcggcggcggcgcgcgagccggcgtcttggacggagacgatggagcggagcttcgcgaggatggacgccgaggtgatcgccggctgccgagccgagagcggcagctgccggtgcgaggggcagaagtgcgaccacgtggggtccaccgcggtggtggccgtcgtggaggagagccgcgtcgtcgtcgccaactgcggcgactcccgcgccgtgctctgccgcggcggcgcgcccgtgcagctatcctccgaccacaagcccgaccgccccgacgagctggagcggatcgaggcggccggcggccgcgtcatcttctgggagggcgcccgtgtcctcggcgtcctcgccatgtcgcgctccatcggcgacgcctacctgaagccctacgtcaccgccgtgccggaggtgacggtgaccggcaggtcggacttcgacgagtgcctcatcctcgccagcgacggcctctgggacgtcgtcagcaacgaggccgcgtgcgaggtggcgcagtcgtgcctccgccgcggcaggcagcggtggtgcgccgaggcggcggcggtgctgaccaagctggccctcgctcgccgcagctccgacaacatctctgtcgtcgtcgtcgatctccggcgaggcaacgccttgtagagagagtgtcacccagctgatgctgtagcatcagtactagtattgcagatattagctaagctaatggttctactaatctttttttttcatttcccttgtgttaaaaatcattttttttctcttctaattttctccctgaattaaccaagttcagtggagcacatagatcaggtgatggggttgtgcaactgctagttggtgtaaccagaatttcatctggataccaactgaaatgaaatgaatattaagc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069416.1 RefSeq:Os09g0325700]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 9]]
 
[[Category:Chromosome 9]]
 

Latest revision as of 12:03, 29 March 2017

The rice Os09g0325700 was reported as OsPP2C68 in 2008 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os09g0325700 <=> OsPP2C68

Function

  • The protein phosphatase 2Cs (PP2Cs) from various organisms have been implicated to act as negative modulators of protein kinase pathways involved in diverse environmental stress responses and developmental processes.[1]
  • Type 2C protein phosphatases directly regulate abscisic acid-activated protein kinases in Arabidopsis.[1] [2]

Expression

  • The expression analyses from the researchers provide evidences that PP2C genes in different subfamilies might play different functional roles in distinct signaling pathways.[1]

Knowledge extension

  • The reversible phosphorylation of proteins is a fundamental mechanism by which living organisms modulate cellular processes including cell cycle events, growth factor responses, hormone and environmental stimuli responses, metabolic control, and developmental processes.[1]

You can also add sub-section(s) at will.

Labs working on this gene

  • State Key Laboratory of Crop Biology, College of Life Sciences, Shandong Agricultural University, Taian, Shandong 271018, PR China
  • Biology Department, Millersville University of Pennsylvania, 288 Roddy Hall, 50 E Frederick St, PO Box 1002, Millersville PA, 17551-0302, USA
  • Department of Chemistry, Fudan University, 220 Handan Road, Shanghai 200433, PR China
  • Institutes of Biomedical Sciences, Fudan University, 130 Dongan Road, Shanghai 200032, PR China
  • Centre for Forest Biology & Department of Biology, University of Victoria, Victoria BC, V8W 3N5, Canada

References

  1. 1.0 1.1 1.2 1.3 1.4 Xue T, Wang D, Zhang S, Ehlting J, Ni F, Jakab S, Zheng C, Zhong Y. Genome-wide and expression analysis of protein phosphatase 2C in rice and Arabidopsis. BMC Genomics. 2008 Nov 20;9:550. doi: 10.1186/1471-2164-9-550. PubMed PMID: 19021904; PubMed Central PMCID: PMC2612031.
  2. Umezawa T, Sugiyama N, Mizoguchi M, Hayashi S, Myouga F, Yamaguchi-Shinozaki K, Ishihama Y, Hirayama T, Shinozaki K. Type 2C protein phosphatases directly regulate abscisic acid-activated protein kinases in Arabidopsis. Proc Natl Acad Sci U S A. 2009 Oct 13;106(41):17588-93. doi: 10.1073/pnas.0907095106. Epub 2009 Sep 29. PubMed PMID: 19805022; PubMed Central PMCID: PMC2754379.

Structured Information