Difference between revisions of "Os06g0217900"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os06g0217900| Description = Cyclin-like domain containing protein| Version = NM_001063688.1 GI:115467107 GeneID:4340499| Length = 2245 bp| Defi...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os06g0217900''''' was reported as '''''Orysa;CycD3;1''''' in 2006 <ref name="ref1" /> by researchers from China.
GeneName = Os06g0217900|
+
==Annotated Information==
Description = Cyclin-like domain containing protein|
+
===Gene Symbol===
Version = NM_001063688.1 GI:115467107 GeneID:4340499|
+
*'''''Os06g0217900''''' '''''<=>''''' '''''Orysa;CycD3;1'''''
Length = 2245 bp|
+
===Function===
Definition = Oryza sativa Japonica Group Os06g0217900, complete gene.|
+
* Cyclins, the known activators for activity of CDKs, play crucial roles for cell cycle progression in eukaryotes.<ref name="ref1" /><ref name="ref2" />
Source = Oryza sativa Japonica Group
+
* In plants, cyclin binding not only activates CDKs by inducing a configuration alteration at the catalytic sites, but also contributes to the subcellular localization and substrate specificity of the complex as well as regulation of protein stability.<ref name="ref1" /><ref name="ref2" />
 +
===Evolution===
 +
* Phylogenetic analysis indicated that both Arabidopsis and rice shared eight types of cyclins, A-, B-, D-, H-, L-, SDS-, T- and P-type, whereas C- and J18-type cyclins were specific to Arabidopsis, and F-type cyclins, lacking clear homologues in Arabidopsis, were unique to rice.<ref name="ref1" />
 +
===Knowledge extension===
 +
* Similar to animals and yeasts, cell proliferation in plants is mainly controlled by a family of cyclin-dependent kinases (CDKs). The activity of CDKs is directly regulated by binding and activation of cyclins as well as other mechanisms that consist of protein phosphorylation/ dephosphorylation by specific kinases/phosphatases, proteolysis, CDK inhibitor protein (CKI) binding, etc.
 +
* Cyclins were initially discovered in marine inverte-brates as proteins that accumulated at specific time points of the cell cycle and were subsequently degraded quickly.<ref name="ref1" />
 +
You can also add sub-section(s) at will.
 +
==Labs working on this gene==
 +
* Rice Functional Genomics, Joint Laboratory of Temasek Life Sciences Laboratory of Singapore and Institute of Genetics and Developmental Biology
 +
* Institute of Genetics and Developmental Biology, The Chinese Academy of Sciences, 100101 Beijing, China
 +
* Rice Functional Genomics Group, Temasek Life Science Laboratory, 1 Research Link, The National University of Singapore, 117604 Singapore, Singapore
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
La H, Li J, Ji Z, Cheng Y, Li X, Jiang S, Venkatesh PN, Ramachandran S.
 +
Genome-wide analysis of cyclin family in rice (Oryza Sativa L.). Mol Genet
 +
Genomics. 2006 Apr;275(4):374-86. Epub 2006 Jan 25. PubMed PMID: 16435118.
 +
</ref>
 +
* <ref name="ref2">
 +
Wang G, Kong H, Sun Y, Zhang X, Zhang W, Altman N, DePamphilis CW, Ma H.
 +
Genome-wide analysis of the cyclin family in Arabidopsis and comparative
 +
phylogenetic analysis of plant cyclin-like proteins. Plant Physiol. 2004
 +
Jun;135(2):1084-99. PubMed PMID: 15208425; PubMed Central PMCID: PMC514142.
 +
</ref>
 +
</references>
  
  ORGANISM  Oryza sativa Japonica Group
+
==Structured Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 6]]
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:6018598..6020842|
 
CDS = 6019582..6019707,6019804..6020005,6020110..6020231,6020410..6020631|
 
GCID = <gbrowseImage1>
 
name=NC_008399:6018598..6020842
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:6018598..6020842
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggagcaattgcattctgagtttcagcaagaggaggcttgtatgacacaactcttagcagtagcttccttgtctttggctgcaaaaatggaggaaaccgttgttccacaccccttggacttgcaggtgtgtgatgcaaaatatgtgtttgagactaggaccataaaaaggatggagcttgcagtgcttaatgccctaaagtggaggatgcaagctgtgactgcttgctcatttatcgattattaccttcacaagttcaatgatgatgatactccgtccacatccgcactctcacgctcagttgacctcatcttgagtacatgtaaagttgctgaattcttggttttcagaccatcagagatcgcggccagtgtagctctagtagcattggaggaacatgaaacttccatgtttgagagggtggcaacttgttacaaaaatttaaagaaggagagggtattacggtgctatgaaatgattcaagataagattattatgagaaacattatgcgccaatcagccggctccgttttctccattccaaaaagccccataggtgtattggatgcagctgcatgtataagccaacaaagtgaggacacttttgttggatcacctgcaacaaattatgagagctcggcgtcaagcaaaaggaggagaatttgcagatga</cdnaseq>|
 
AA = <aaseq>MEQLHSEFQQEEACMTQLLAVASLSLAAKMEETVVPHPLDLQVC                    DAKYVFETRTIKRMELAVLNALKWRMQAVTACSFIDYYLHKFNDDDTPSTSALSRSVD                    LILSTCKVAEFLVFRPSEIAASVALVALEEHETSMFERVATCYKNLKKERVLRCYEMI                    QDKIIMRNIMRQSAGSVFSIPKSPIGVLDAAACISQQSEDTFVGSPATNYESSASSKR                    RRICR</aaseq>|
 
DNA = <dnaseqindica>985..1110#1207..1408#1513..1634#1813..2034#gaccccttctcgccttctcttcctcacccctcctctcatttcaagaagaacaagagaaagctaagaacattttctagctctcaagtagtactcctatataataccaagaagagaagcagtaatagtctggggaggcttgaagggggaggagaagcatcaaatcgaaacagaccaacagaatctgaaaaatttactagtggtagaacaagattagtcctttcctcttccaaataatagtggattagctactagtttattagttcctttcttctaccaagtagtggattagagattagctactagtttgcaccttgaagagtgatctaggatggcaccgagctttgattttgcggcatcaatcctcctttgcgcggaggacaacaccgccattcttgatcttggcgaagagagcgaggagatttcttgggttgttggggttgatgcttctctaggggacttgtcgatggatttccccttgcaatccgatgattgcatcgaggccctcctggggagggaggagcagcagcacatccccatggagggctacctccagcggcttctgctgcagcctgatgggctcgatttggtagccgtcaggagcgacgccattgactggatttggaaggtgagcttctgttcgttgtttttcatcactccttgctagtactattcaggatgagatgtgatggtatacatttcggtaaaaatgtccccttttgttgcgttgttttgtgttctcctgttcttgatttggttcttgctggtttacctgtcatgccctgtatacgatttgactgaaactgttgcttgtcaggtacatgagctttataagtttgggcctttgactgcagtcctgtcggtgaactacctggaccggttcctctccgtgttcgatcttcctgtaaagatctttctctgcattgcattgttactgtatttcatacaaactcgatttttttatgcttctgagataaatgccaagtcatggagcaattgcattctgagtttcagcaagaggaggcttgtatgacacaactcttagcagtagcttccttgtctttggctgcaaaaatggaggaaaccgttgttccacaccccttggacttgcaggtgaaatcaattatcatacatgcaacagttgtgcacaaatactatcaaagtttttcttttctcatttctttcagtttgatattttctgttttgtaggtgtgtgatgcaaaatatgtgtttgagactaggaccataaaaaggatggagcttgcagtgcttaatgccctaaagtggaggatgcaagctgtgactgcttgctcatttatcgattattaccttcacaagttcaatgatgatgatactccgtccacatccgcactctcacgctcagttgacctcatcttgagtacatgtaaaggtgtgaattttggtagacatgtttgtagttccactccatgcctccatcaatattatagattgttatggtgatgaactcttaaatctgggaattttggtctgcagttgctgaattcttggttttcagaccatcagagatcgcggccagtgtagctctagtagcattggaggaacatgaaacttccatgtttgagagggtggcaacttgttacaaaaatttaaagaaggtactgaatctcttgatctttcaatacactgttcttaaactgacaaaagattctgtcttttgttggatgacactaatttcttagtaactctgttagtttgtcttgcttgcattaagaggcattcatctgtgatcgggtgcttttcaaattttaatagaatgttacttgaatgttgtaggagagggtattacggtgctatgaaatgattcaagataagattattatgagaaacattatgcgccaatcagccggctccgttttctccattccaaaaagccccataggtgtattggatgcagctgcatgtataagccaacaaagtgaggacacttttgttggatcacctgcaacaaattatgagagctcggcgtcaagcaaaaggaggagaatttgcagatgattgttttcgttgtacatttgtagccttcaagtatgttgctcacccatttgttttaatggacccaagaacatggtcattaggacaggtttttgtagagacgagcaatctcttgttatttcgcattcatgcttccatattcatttttgagagaaccttggagaatggatatgctttgatgattctaaagaaaatataaaaacagaggaaaagg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063688.1 RefSeq:Os06g0217900]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 6]]
 
[[Category:Chromosome 6]]
 

Latest revision as of 02:17, 30 March 2017

The rice Os06g0217900 was reported as Orysa;CycD3;1 in 2006 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os06g0217900 <=> Orysa;CycD3;1

Function

  • Cyclins, the known activators for activity of CDKs, play crucial roles for cell cycle progression in eukaryotes.[1][2]
  • In plants, cyclin binding not only activates CDKs by inducing a configuration alteration at the catalytic sites, but also contributes to the subcellular localization and substrate specificity of the complex as well as regulation of protein stability.[1][2]

Evolution

  • Phylogenetic analysis indicated that both Arabidopsis and rice shared eight types of cyclins, A-, B-, D-, H-, L-, SDS-, T- and P-type, whereas C- and J18-type cyclins were specific to Arabidopsis, and F-type cyclins, lacking clear homologues in Arabidopsis, were unique to rice.[1]

Knowledge extension

  • Similar to animals and yeasts, cell proliferation in plants is mainly controlled by a family of cyclin-dependent kinases (CDKs). The activity of CDKs is directly regulated by binding and activation of cyclins as well as other mechanisms that consist of protein phosphorylation/ dephosphorylation by specific kinases/phosphatases, proteolysis, CDK inhibitor protein (CKI) binding, etc.
  • Cyclins were initially discovered in marine inverte-brates as proteins that accumulated at specific time points of the cell cycle and were subsequently degraded quickly.[1]

You can also add sub-section(s) at will.

Labs working on this gene

  • Rice Functional Genomics, Joint Laboratory of Temasek Life Sciences Laboratory of Singapore and Institute of Genetics and Developmental Biology
  • Institute of Genetics and Developmental Biology, The Chinese Academy of Sciences, 100101 Beijing, China
  • Rice Functional Genomics Group, Temasek Life Science Laboratory, 1 Research Link, The National University of Singapore, 117604 Singapore, Singapore

References

  1. 1.0 1.1 1.2 1.3 1.4 La H, Li J, Ji Z, Cheng Y, Li X, Jiang S, Venkatesh PN, Ramachandran S. Genome-wide analysis of cyclin family in rice (Oryza Sativa L.). Mol Genet Genomics. 2006 Apr;275(4):374-86. Epub 2006 Jan 25. PubMed PMID: 16435118.
  2. 2.0 2.1 Wang G, Kong H, Sun Y, Zhang X, Zhang W, Altman N, DePamphilis CW, Ma H. Genome-wide analysis of the cyclin family in Arabidopsis and comparative phylogenetic analysis of plant cyclin-like proteins. Plant Physiol. 2004 Jun;135(2):1084-99. PubMed PMID: 15208425; PubMed Central PMCID: PMC514142.

Structured Information