Difference between revisions of "Os02g0818000"

From RiceWiki
Jump to: navigation, search
 
(4 intermediate revisions by 3 users not shown)
Line 1: Line 1:
'''''UIP1''''' (3'-UTR-interacting protein 1) acts as a chaperone protein of ''RbcS1'' transcripts by associating with the RbcS1 3'-UTR in an event of SMD leading them to either PBs or SGs<ref name="ref1"/>.
+
The rice '''''Os02g0818000''''' was reported as '''''OsCBSX3a''''' in 2009 <ref name="ref1" /> by researchers from India.  
 
==Annotated Information==
 
==Annotated Information==
 +
===Gene Symbol===
 +
*'''''Os02g0818000''''' '''''<=>''''' '''''OsCBSX3a'''''
 
===Function===
 
===Function===
The '''CBS domain''' of ''UIP1'' is necessary for '''binding to 3' ''RbcS'''''. ''UIP1'' interacts with 3' untranslated region of ''RbcS1'' mRNA and '''increases tolerance''' of transgenic overexpressors to '''drought stress'''<ref name="ref1"/>.
+
* CBS domains are found to be associated with several proteins of unrelated functions, such as inosine-5'-mono- phosphate dehydrogenase (IMPDH), AMP-activated protein kinase (AMPK), chloride channels (CLC) and cys-tathionine-β-synthase (CBS).  
 
+
* Mutation in CBS domains abolish or strongly reduce activation by SAM and cause homocystinuria.  
===Mutation===
+
* CBS domain of γ-subunit of AMPK acts as sensor of cellular energy status and mutations cause a glycogen storage disease, which is clinically expressed as a familial hypertrophic cardiomyopathy.
transgenic and nontransgenic (NT) control plants<ref name="ref1"/>:
+
===Evolution===
*During drought stress conditions, NT plants started to show '''visual symptoms''' of drought-induced '''damage''' such as leaf rolling and wilting with a concomitant loss of chlorophylls at an earlier stage than the ''OsCc1:UIP1'' plants.  
+
* CBS domain exists not only in archaebacterial proteins, but also in eubacterial and eukaryotic proteins
*Upon rewatering, transgenic plants '''recovered well''' compared to the NT plants. Consequently, NT plants remained severely affected by drought stress while transgenic lines partially recovered after 3 days of rewatering.
+
* In CBS protein, C-terminal CBS domain exerts an autoin-hibitory effect on the CBS activity, while binding of SAM (S-adenosylmethionine) with CBS domain induces a conformational change which relieves the autoinhibitory effect.
*The Fv/Fm values of the ''OsCc1:UIP1'' plants were '''higher''' than those of the NT plants under the time course of stress treatments.  
+
You can also add sub-section(s) at will.
 
 
===Expression===
 
*Transgenic overexpression of ''UIP1'' in rice resulted in an '''increase in tolerance to drought stress''' at the '''vegetative stage''' of growth. Under '''drought''', '''high salt''' and '''low temperature''' conditions, the maximum photochemical efficiency of photosystem II (Fv/Fm) of UIP1 plants was '''higher''' than those of the nontransgenic plants<ref name="ref1"/>.
 
 
 
*Interestingly, the effect of ''UIP1'' overexpression on tolerance to stress was much '''more pronounced''' under drought than under high salt and low temperature conditions<ref name="ref1"/>.
 
 
 
===Knowledge Extension===
 
The 3'RbcS is the major mRNA region involved in a phenomenon referred to as stress-induced mRNA decay (SMD) under drought and salt stress conditions. SMD was observed on the mRNAs of photosynthetic genes (e.g., RbcS1, Cab1, and PCY) that are rapidly degraded when
 
plants are exposed to stress<ref name="ref2"/>.
 
 
 
 
==Labs working on this gene==
 
==Labs working on this gene==
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449-728, Korea
+
* Centre for Computational Biology and Bioinformatics, School of Information Technology, Jawaharlal Nehru University, New Delhi 110067, India
 
+
* Plant Molecular Biology, International Centre for Genetic Engineering and Biotechnology, New Delhi 110067, India
 +
* Stress Physiology and Molecular Biology, School of Life Sciences, Jawaharlal Nehru University, New Delhi 110067, India
 
==References==
 
==References==
 
<references>
 
<references>
 
* <ref name="ref1">
 
* <ref name="ref1">
Park S H, Jeong J S, Redillas M C F R, et al. Transgenic overexpression of UIP1, an interactor of the 3′ untranslated region of the Rubisco small subunit mRNA, increases rice tolerance to drought[J]. Plant biotechnology reports, 2013, 7(1): 83-90.
+
Kushwaha HR, Singh AK, Sopory SK, Singla-Pareek SL, Pareek A. Genome wide
 +
expression analysis of CBS domain containing proteins in Arabidopsis thaliana
 +
(L.) Heynh and Oryza sativa L. reveals their developmental and stress regulation.
 +
BMC Genomics. 2009 Apr 28;10:200. doi: 10.1186/1471-2164-10-200. PubMed PMID:
 +
19400948; PubMed Central PMCID: PMC2694836.
 
</ref>
 
</ref>
* <ref name="ref2">
 
Park S H, Chung P J, Juntawong P, et al. Posttranscriptional control of photosynthetic mRNA decay under stress conditions requires 3′ and 5′ untranslated regions and correlates with differential polysome association in rice[J]. Plant physiology, 2012, 159(3): 1111-1124.
 
 
</references>
 
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os02g0818000|
 
Description = CBS domain containing protein|
 
Version = NM_001055060.1 GI:115449676 GeneID:4331153|
 
Length = 2152 bp|
 
Definition = Oryza sativa Japonica Group Os02g0818000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:35978345..35980496|
 
CDS = 35979184..35979200,35979351..35979522,35979640..35979816,35979925..35979994,35980085..35980156<br>,35980289..35980344|
 
GCID = <gbrowseImage1>
 
name=NC_008395:35978345..35980496
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:35978345..35980496
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>aggcctccggctacgatcttccggtgccgggcatcgacgttcatggacgggagcctccggctagagatcgacgagaaccctgaagccatcatctccggtgagtggccggagaacttctccctgctcagctacgacgatctccgcgcctacctccagtcacaggaggccgctgctcaagccgacaaccagcgtgtggcgctcctgagtgaagccatgtcggcgcctgtgctggtagccactgccgagcagacgctggaggaggttgagtgccactttgagacggtctcaggtctcccagttatagatgccagcctcagatgtgttggagtgatcgtcaagagtgaccgggccagggcttctcatgggtcaaagacgaagattgcagaagtgatgacctctccagccatcactctaccatctgacaaaacagtaatggatgcggcagctctgatgctaaagaagaagatccacagattaccaattgtaaatcaggacagacaagtgataggtatagttacccgtgctgacgttcttcgcgagttggaagccctgctggaggtttag</cdnaseq>|
 
AA = <aaseq>RPPATIFRCRASTFMDGSLRLEIDENPEAIISGEWPENFSLLSY                    DDLRAYLQSQEAAAQADNQRVALLSEAMSAPVLVATAEQTLEEVECHFETVSGLPVID                    ASLRCVGVIVKSDRARASHGSKTKIAEVMTSPAITLPSDKTVMDAAALMLKKKIHRLP                    IVNQDRQVIGIVTRADVLRELEALLEV</aaseq>|
 
DNA = <dnaseqindica>840..856#1007..1178#1296..1472#1581..1650#1741..1812#1945..2000#cggccaagctcgactgcaagttcagcaagcaacttggcagatgcatacacagcatcgaagcatccaagatcgatcgcccacctaacacggcgagctatctgttttccagcggcgaaagaaaccacgggcacggcgagtcggctcaccggccggccggtcggtactcagtaccaaaccaaaggtcaggatgatccggcttatccactgccacgtgacctgggcccaagagaatcccgccagccaatcgccgcgcgccacgtcgcccgctctgtccctgtagaacacacaatcatgtccgaattccacgtcagtccacatccaaacttggagaaatctgagagaattactcacactaacctgacttcttcactgatgaatgcaacccatcgtacttggtagtagtagtacatatccatataaccatatcctgtttcaggccttgtcagtgacaccttggttaaaaccacccatgcaccattctgctgctctcaaatcactatcctgaatacactaatctcaatctaattactaagtttcagccaaacctcagaatatgcaaaatagtcatcttcagcttgcaatttgcagatccataagttttgccatatgcatggactatgataaatgccacctctgaatctctgatagcagaaacaaatgatgatgagatactaacaagcactaatggagtattaaaaaagatctgagcatggatgaggtcaaagtccaccaataggatctgagcagtagcagtcattggtgggccagcacctcccatgcattcctatccacctcagctccctgacaatagacgcaagtatccagttcactataaatgaaggcctccggctacgatctgcaggagaaaaaacagtcagaagctaaggaagaaaaagtatagacacagtgatacaatggcctgcatcaacacattccagagctgctccgtcctcaagggagcaaagatcaatggtaccaagatcggaggagggaggggatcaccaaccttccggtgccgggcatcgacgttcatggacgggagcctccggctagagatcgacgagaaccctgaagccatcatctccggtgagtggccggagaacttctccctgctcagctacgacgatctccgcgcctacctccagtcacaggaggccgctgctcaagccgacaaccaggtgcactgatcacaccatatatacatagattcttcttcttcagatcaccaactgtcgatcttcttcttaagatcttgctaaactctgaactggttgcatggttggtgaattgaccagcgtgtggcgctcctgagtgaagccatgtcggcgcctgtgctggtagccactgccgagcagacgctggaggaggttgagtgccactttgagacggtctcaggtctcccagttatagatgccagcctcagatgtgttggagtgatcgtcaagagtgaccgggccagggcttctcatggggtcagctctctttctcctctcacacacacatacatgatacatatccctctcactcacgcacatactcaacaacaaaaataagtgctgatctattgcttcttgtaacagtcaaagacgaagattgcagaagtgatgacctctccagccatcactctaccatctgacaaaacagtaatgggtaatccatcgttgttttcgcccttattttttttggttattttccacttagctaccagttaagctaacaaggcatatgcaatgtctacagatgcggcagctctgatgctaaagaagaagatccacagattaccaattgtaaatcaggacagacaagtgataggtgagttttgagcagtggccaatacagaaaaaaaaagggctttcattttttccccttgattttataccatccttaacattgataattcagagtatgttgcatgctaaatggagttccaaacactattaacaggtatagttacccgtgctgacgttcttcgcgagttggaagccctgctggaggtttagacgtgcagtggtccatatgcttcggccttgttgtatatatgtaaatatatgccatggtgtttttgaatagcaggcatctctaatctgtaagagtgttgtagcgcgaatcaccaagataagcctgagaaaataaccggagagcttttctttgt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055060.1 RefSeq:Os02g0818000]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 02:42, 30 March 2017

The rice Os02g0818000 was reported as OsCBSX3a in 2009 [1] by researchers from India.

Annotated Information

Gene Symbol

  • Os02g0818000 <=> OsCBSX3a

Function

  • CBS domains are found to be associated with several proteins of unrelated functions, such as inosine-5'-mono- phosphate dehydrogenase (IMPDH), AMP-activated protein kinase (AMPK), chloride channels (CLC) and cys-tathionine-β-synthase (CBS).
  • Mutation in CBS domains abolish or strongly reduce activation by SAM and cause homocystinuria.
  • CBS domain of γ-subunit of AMPK acts as sensor of cellular energy status and mutations cause a glycogen storage disease, which is clinically expressed as a familial hypertrophic cardiomyopathy.

Evolution

  • CBS domain exists not only in archaebacterial proteins, but also in eubacterial and eukaryotic proteins
  • In CBS protein, C-terminal CBS domain exerts an autoin-hibitory effect on the CBS activity, while binding of SAM (S-adenosylmethionine) with CBS domain induces a conformational change which relieves the autoinhibitory effect.

You can also add sub-section(s) at will.

Labs working on this gene

  • Centre for Computational Biology and Bioinformatics, School of Information Technology, Jawaharlal Nehru University, New Delhi 110067, India
  • Plant Molecular Biology, International Centre for Genetic Engineering and Biotechnology, New Delhi 110067, India
  • Stress Physiology and Molecular Biology, School of Life Sciences, Jawaharlal Nehru University, New Delhi 110067, India

References

  1. Kushwaha HR, Singh AK, Sopory SK, Singla-Pareek SL, Pareek A. Genome wide expression analysis of CBS domain containing proteins in Arabidopsis thaliana (L.) Heynh and Oryza sativa L. reveals their developmental and stress regulation. BMC Genomics. 2009 Apr 28;10:200. doi: 10.1186/1471-2164-10-200. PubMed PMID: 19400948; PubMed Central PMCID: PMC2694836.

Structured Information