Difference between revisions of "Os09g0431600"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os09g0431600| Description = CBS domain containing protein| Version = NM_001069774.2 GI:297609520 GeneID:4347128| Length = 1547 bp| Definition =...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os09g0431600''''' was reported as '''''OsCBSPPR1''''' in 2009 <ref name="ref1" /> by researchers from India.
GeneName = Os09g0431600|
+
==Annotated Information==
Description = CBS domain containing protein|
+
===Gene Symbol===
Version = NM_001069774.2 GI:297609520 GeneID:4347128|
+
*'''''Os09g0431600''''' '''''<=>''''' '''''OsCBSPPR1'''''
Length = 1547 bp|
+
===Function===
Definition = Oryza sativa Japonica Group Os09g0431600, complete gene.|
+
* CBS domains are found to be associated with several proteins of unrelated functions, such as inosine-5'-mono- phosphate dehydrogenase (IMPDH), AMP-activated protein kinase (AMPK), chloride channels (CLC) and cys-tathionine-β-synthase (CBS).
Source = Oryza sativa Japonica Group
+
* Mutation in CBS domains abolish or strongly reduce activation by SAM and cause homocystinuria.
 +
* CBS domain of γ-subunit of AMPK acts as sensor of cellular energy status and mutations cause a glycogen storage disease, which is clinically expressed as a familial hypertrophic cardiomyopathy.
 +
===Evolution===
 +
* CBS domain exists not only in archaebacterial proteins, but also in eubacterial and eukaryotic proteins
 +
* In CBS protein, C-terminal CBS domain exerts an autoin-hibitory effect on the CBS activity, while binding of SAM (S-adenosylmethionine) with CBS domain induces a conformational change which relieves the autoinhibitory effect.
 +
You can also add sub-section(s) at will.
 +
==Labs working on this gene==
 +
* Centre for Computational Biology and Bioinformatics, School of Information Technology, Jawaharlal Nehru University, New Delhi 110067, India
 +
* Plant Molecular Biology, International Centre for Genetic Engineering and Biotechnology, New Delhi 110067, India
 +
* Stress Physiology and Molecular Biology, School of Life Sciences, Jawaharlal Nehru University, New Delhi 110067, India
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Kushwaha HR, Singh AK, Sopory SK, Singla-Pareek SL, Pareek A. Genome wide
 +
expression analysis of CBS domain containing proteins in Arabidopsis thaliana
 +
(L.) Heynh and Oryza sativa L. reveals their developmental and stress regulation.
 +
BMC Genomics. 2009 Apr 28;10:200. doi: 10.1186/1471-2164-10-200. PubMed PMID:
 +
19400948; PubMed Central PMCID: PMC2694836.
 +
</ref>
 +
</references>
  
  ORGANISM  Oryza sativa Japonica Group
+
==Structured Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 9]]
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:16452684..16454230|
 
CDS = 16452685..16452771,16453711..16453995|
 
GCID = <gbrowseImage1>
 
name=NC_008402:16452684..16454230
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:16452684..16454230
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgcgattcttcaaggatcctgtagttcctattgttgatgactggggaagctgcgtgggtattgttcaccgacaggattgtaccaagatcgatgcgcctcttctatcaatgtcgagaggaccaccgctatgtgttcctacgtccacctctgtcgagcatgtcatagatctcctcctcagagaaaaatctgaaatggtggtcgtggtgaaaagaggcaacatgtacgaaggcagttacgcatccagctcgcgcccgttgggagttttctccctcgcaatcttgtggaagttcaccgctgacgcgacagacatcgatggcatggacgcagcgcaccagctccagcaggatgtggaagccagcaattgtggctga</cdnaseq>|
 
AA = <aaseq>MRFFKDPVVPIVDDWGSCVGIVHRQDCTKIDAPLLSMSRGPPLC                    VPTSTSVEHVIDLLLREKSEMVVVVKRGNMYEGSYASSSRPLGVFSLAILWKFTADAT                    DIDGMDAAHQLQQDVEASNCG</aaseq>|
 
DNA = <dnaseqindica>2..88#1028..1312#catgcgattcttcaaggatcctgtagttcctattgttgatgactggggaagctgcgtgggtattgttcaccgacaggattgtaccaaggtacgttatctcctttagttggtaccagcaataatagcgttgatccttgcacgaaagctagtggaatggttagcacttgttttagcggcagggaccagtcaccagtgttaggataaaaaaaatcaaccaccttagcttctcttccaaacagttcaagtttggtcaaggattatattacaaggaggaaaccaataacaaattttggtcgtttttcattttcattcaagggcgtatatatttccttccagtattaaccttaataaactcaactgattttggtctttactaaaaacaatgcttgcccatgatgaaatgaaccataggtttgcttttacccttttaaactcaatcggcagtctatctagtgctagaagcatgactgggtgtgagaggctaccacacttatttgcttgtggtattagccttaacaataattgatttgggacttcactaaaaattggctcgtccatgatgaactataggtttgcccttatcctttattcattggcagtctatctagtactagaagcacgattggctgcaagaggatgcgatattatccttaacaaactcaactgatttgggagttgggagttaactaaaaaatggctggcagtctatctagtgctagaagcacgattggctgcaagaggatacgccactaattttcttgctatattagccttaacaaactcaactgatttgggagtttgctaaaattcggcttgtccatgatgaaccataggtttgctcttatcgtttaaaattcatcggcagtctatctctagtgctagaagcatgattggttgcaagaggatgccacacctctatcaaactttgtacaatgatataatgtttcttaacagcttcagtgccgacataattgtcggtattatagtattctcttgtcgctctaaaatcctttaaatctgctctcagatcgatgcgcctcttctatcaatgtcgagaggaccaccgctatgtgttcctacgtccacctctgtcgagcatgtcatagatctcctcctcagagaaaaatctgaaatggtggtcgtggtgaaaagaggcaacatgtacgaaggcagttacgcatccagctcgcgcccgttgggagttttctccctcgcaatcttgtggaagttcaccgctgacgcgacagacatcgatggcatggacgcagcgcaccagctccagcaggatgtggaagccagcaattgtggctgagtgcattgctagttttttctgtgactccacatctgtgattggctgggtgaaaagtcttgggctaatgaatggctttgctcgaagcgcagtgaattggttttgctctgcccatatgtgtccattgggccatagcataaagcgttgtcatcgacgaactgtagtgattctgaccccattgacagatgtagtttgatgtactacacatcaaagtgggctactacgtgtgttgggattg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069774.2 RefSeq:Os09g0431600]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 9]]
 
[[Category:Chromosome 9]]
 

Latest revision as of 03:15, 30 March 2017

The rice Os09g0431600 was reported as OsCBSPPR1 in 2009 [1] by researchers from India.

Annotated Information

Gene Symbol

  • Os09g0431600 <=> OsCBSPPR1

Function

  • CBS domains are found to be associated with several proteins of unrelated functions, such as inosine-5'-mono- phosphate dehydrogenase (IMPDH), AMP-activated protein kinase (AMPK), chloride channels (CLC) and cys-tathionine-β-synthase (CBS).
  • Mutation in CBS domains abolish or strongly reduce activation by SAM and cause homocystinuria.
  • CBS domain of γ-subunit of AMPK acts as sensor of cellular energy status and mutations cause a glycogen storage disease, which is clinically expressed as a familial hypertrophic cardiomyopathy.

Evolution

  • CBS domain exists not only in archaebacterial proteins, but also in eubacterial and eukaryotic proteins
  • In CBS protein, C-terminal CBS domain exerts an autoin-hibitory effect on the CBS activity, while binding of SAM (S-adenosylmethionine) with CBS domain induces a conformational change which relieves the autoinhibitory effect.

You can also add sub-section(s) at will.

Labs working on this gene

  • Centre for Computational Biology and Bioinformatics, School of Information Technology, Jawaharlal Nehru University, New Delhi 110067, India
  • Plant Molecular Biology, International Centre for Genetic Engineering and Biotechnology, New Delhi 110067, India
  • Stress Physiology and Molecular Biology, School of Life Sciences, Jawaharlal Nehru University, New Delhi 110067, India

References

  1. Kushwaha HR, Singh AK, Sopory SK, Singla-Pareek SL, Pareek A. Genome wide expression analysis of CBS domain containing proteins in Arabidopsis thaliana (L.) Heynh and Oryza sativa L. reveals their developmental and stress regulation. BMC Genomics. 2009 Apr 28;10:200. doi: 10.1186/1471-2164-10-200. PubMed PMID: 19400948; PubMed Central PMCID: PMC2694836.

Structured Information