Difference between revisions of "Os09g0480700"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os09g0480700| Description = Similar to Transcription factor Hap5a-like protein| Version = NM_001070024.1 GI:115479790 GeneID:4347391| Length = 1...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
 
GeneName = Os09g0480700|
 
Description = Similar to Transcription factor Hap5a-like protein|
 
Version = NM_001070024.1 GI:115479790 GeneID:4347391|
 
Length = 1097 bp|
 
Definition = Oryza sativa Japonica Group Os09g0480700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
The rice '''''Os09g0480700''''' was reported as '''''OsNF-YC7''''' in 2016 <ref name="ref1" /> by researchers from China.  
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
==Annotated Information==
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
===Gene Symbol===
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
*'''''Os09g0480700''''' '''''<=>''''' '''''OsNF-YC7'''''
|
+
===Function===
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
+
* Nuclear factor γ (NF-γ) is a ubiquitous transcription factor that regulates important physiological and developmental processes.<ref name="ref1" />
AP = Chromosome 9:19105323..19106419|
+
* In plants, the roles of NF-γ were identified in regulation of embryogenesis, flowering time, chloroplast biogenesis, seed germination and stress tolerance.<ref name="ref1" /> <ref name="ref2" />  
CDS = 19105324..19105402,19105579..19106006|
+
===Expression===
GCID = <gbrowseImage1>
+
* Expression profile analysis covering the whole life cycle revealed that transcripts of OsNF-γ differentially accumulated in a tissue-specific preferential or constitutive manner.<ref name="ref1" />  
name=NC_008402:19105323..19106419
+
* Analysis of expression correlation and Gene Ontology annotation suggested that OsNF-Y genes were co-expressed with genes that participated in stress, accumulation of seed storage reserves, and plant development.
source=RiceChromosome09
+
* Co-expression analysis also revealed that OsNF-Y genes might interact with each other, suggesting that NF-γ subunits formed complexes that take part in transcriptional regulation.<ref name="ref1" />  
preset=GeneLocation
+
===Evolution===
</gbrowseImage1>|
+
* NF-γ is a heterotrimeric complex composed of three subunits: NF-γA (CBF-B/HAP2), NF-γB (CBF-A/HAP3), and NF-γC
GSID = <gbrowseImage2>
+
(CBF-C/HAP5).  
name=NC_008402:19105323..19106419
+
* NF-γ complexes are CCAAT-specific transcription factors that bind to CCAAT sites in DNA to control the expression of target genes<ref name="ref1" /> .
source=RiceChromosome09
+
You can also add sub-section(s) at will.
preset=GeneLocation
+
==Labs working on this gene==
</gbrowseImage2>|
+
* College of Life Science and Technology, Huazhong Agricultural University, Wuhan, 430070, China
CDNA = <cdnaseq>agtgaagagaagcagcaaagagagagcttttccatccccaaatcccctcctcctcctcaaaccctagctaagctccgctcgcagcagcagctgcagatgttctgggcggagcagtaccgcgagatcgaggccaccaccgacttcaagaaccacaacctccccctggcccgcatcaagaagatcatgaaggccgacgaggacgtccgcatgatcgccgccgaggcccccgtcgtgttcgcccgcgcctgcgagatgttcatcctcgagctcacccaccgcggctgggcgcacgccgaggagaacaagcgccgtacgctgcagaagtccgacattgccgccgccatcgcgcgcaccgaggtgttcgacttcctcgtcgacatcgtgccccgcgacgacgccaaggacgccgacgccgccgcggccgcggcggcggccggcatcccccgccccgccgccggtgtgccggccaccgatccgctcgcctactactatgtgccccagcagtaa</cdnaseq>|
+
* College of Plant Science and Technology, Huazhong Agricultural University, Wuhan, 430070, China
AA = <aaseq>SEEKQQRESFSIPKSPPPPQTLAKLRSQQQLQMFWAEQYREIEA                    TTDFKNHNLPLARIKKIMKADEDVRMIAAEAPVVFARACEMFILELTHRGWAHAEENK                    RRTLQKSDIAAAIARTEVFDFLVDIVPRDDAKDADAAAAAAAAGIPRPAAGVPATDPL                    AYYYVPQQ</aaseq>|
+
==References==
DNA = <dnaseqindica>2..80#257..684#aagtgaagagaagcagcaaagagagagcttttccatccccaaatcccctcctcctcctcaaaccctagctaagctccgctcgcagcagccatggatcccaccaaatccagcacgccgccgccggtgatgggcgcgcccgtcggcttcccgcctggcgcgtaccctccgcctccccccgccggcgccgccgccgccgcctacgcgcagcagctctacgcgccccccgccgccgcggcggcgcagcaggcggcggcggcgcagcagcagctgcagatgttctgggcggagcagtaccgcgagatcgaggccaccaccgacttcaagaaccacaacctccccctggcccgcatcaagaagatcatgaaggccgacgaggacgtccgcatgatcgccgccgaggcccccgtcgtgttcgcccgcgcctgcgagatgttcatcctcgagctcacccaccgcggctgggcgcacgccgaggagaacaagcgccgtacgctgcagaagtccgacattgccgccgccatcgcgcgcaccgaggtgttcgacttcctcgtcgacatcgtgccccgcgacgacgccaaggacgccgacgccgccgcggccgcggcggcggccggcatcccccgccccgccgccggtgtgccggccaccgatccgctcgcctactactatgtgccccagcagtaatgtatctgattaacccctttcaagccttttctaagcgaaggatgtgttgttgtttgttgttgctgttgctgttcttgttgttgttgttgccgcgtaataagatatgttgataatttatggcttcccctgagcttaaagaatttgagcttttggttctagaatctgggtaaaattgttgtaatggggaagactgtatgactgtatttgtagtgcatgtcttaacttgtcggatagtgtaatccgataattattatgcggttagctggttacctctcatgattactgtgctcatgtgctgtgcaatttatgttctttgttttggatgtacaatgctgtaaccagaatttggttgtgtaaggaaactattaaaggttgtgcgagggcagtgtggctatcgctgcattttagcttac</dnaseqindica>|
+
<references>
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070024.1 RefSeq:Os09g0480700]|
+
* <ref name="ref1">
}}
+
Yang, W., Lu, Z., Xiong, Y., & Yao, J. (2016). Genome-wide identification and co-expression network analysis of the OsNF-γ gene family in rice. The Crop Journal.
[[Category:Genes]]
+
</ref>
[[Category:Japonica mRNA]]
+
* <ref name="ref2">
[[Category:Oryza Sativa Japonica Group]]
+
Laloum T, De Mita S, Gamas P, Baudin M, Niebel A. CCAAT-box binding
[[Category:Japonica Genes]]
+
transcription factors in plants: Y so many? Trends Plant Sci. 2013
[[Category:Japonica Chromosome 9]]
+
Mar;18(3):157-66. doi: 10.1016/j.tplants.2012.07.004. Epub 2012 Aug 30. Review.
[[Category:Chromosome 9]]
+
Erratum in: Trends Plant Sci. 2013 Oct;18(10):594-5. PubMed PMID: 22939172.
 +
</ref>
 +
</references>
 +
 
 +
==Structured Information==
 +
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 9]]

Latest revision as of 03:59, 31 March 2017

The rice Os09g0480700 was reported as OsNF-YC7 in 2016 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os09g0480700 <=> OsNF-YC7

Function

  • Nuclear factor γ (NF-γ) is a ubiquitous transcription factor that regulates important physiological and developmental processes.[1]
  • In plants, the roles of NF-γ were identified in regulation of embryogenesis, flowering time, chloroplast biogenesis, seed germination and stress tolerance.[1] [2]

Expression

  • Expression profile analysis covering the whole life cycle revealed that transcripts of OsNF-γ differentially accumulated in a tissue-specific preferential or constitutive manner.[1]
  • Analysis of expression correlation and Gene Ontology annotation suggested that OsNF-Y genes were co-expressed with genes that participated in stress, accumulation of seed storage reserves, and plant development.
  • Co-expression analysis also revealed that OsNF-Y genes might interact with each other, suggesting that NF-γ subunits formed complexes that take part in transcriptional regulation.[1]

Evolution

  • NF-γ is a heterotrimeric complex composed of three subunits: NF-γA (CBF-B/HAP2), NF-γB (CBF-A/HAP3), and NF-γC

(CBF-C/HAP5).

  • NF-γ complexes are CCAAT-specific transcription factors that bind to CCAAT sites in DNA to control the expression of target genes[1] .

You can also add sub-section(s) at will.

Labs working on this gene

  • College of Life Science and Technology, Huazhong Agricultural University, Wuhan, 430070, China
  • College of Plant Science and Technology, Huazhong Agricultural University, Wuhan, 430070, China

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 Yang, W., Lu, Z., Xiong, Y., & Yao, J. (2016). Genome-wide identification and co-expression network analysis of the OsNF-γ gene family in rice. The Crop Journal.
  2. Laloum T, De Mita S, Gamas P, Baudin M, Niebel A. CCAAT-box binding transcription factors in plants: Y so many? Trends Plant Sci. 2013 Mar;18(3):157-66. doi: 10.1016/j.tplants.2012.07.004. Epub 2012 Aug 30. Review. Erratum in: Trends Plant Sci. 2013 Oct;18(10):594-5. PubMed PMID: 22939172.

Structured Information