Difference between revisions of "Os05g0304800"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os05g0304800| Description = Histone-fold domain containing protein| Version = NM_001061679.2 GI:297604231 GeneID:4338359| Length = 1557 bp| Def...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os05g0304800''''' was reported as '''''OsNF-YC12''''' in 2016 <ref name="ref1" /> by researchers from China.
GeneName = Os05g0304800|
+
==Annotated Information==
Description = Histone-fold domain containing protein|
+
===Gene Symbol===
Version = NM_001061679.2 GI:297604231 GeneID:4338359|
+
*'''''Os05g0304800''''' '''''<=>''''' '''''OsNF-YC12'''''
Length = 1557 bp|
+
===Function===
Definition = Oryza sativa Japonica Group Os05g0304800, complete gene.|
+
* Nuclear factor γ (NF-γ) is a ubiquitous transcription factor that regulates important physiological and developmental processes.<ref name="ref1" />
Source = Oryza sativa Japonica Group
+
* In plants, the roles of NF-γ were identified in regulation of embryogenesis, flowering time, chloroplast biogenesis, seed germination and stress tolerance.<ref name="ref1" /> <ref name="ref2" />
 
+
===Expression===
  ORGANISM  Oryza sativa Japonica Group
+
* Expression profile analysis covering the whole life cycle revealed that transcripts of OsNF-γ differentially accumulated in a tissue-specific preferential or constitutive manner.<ref name="ref1" />
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
* Analysis of expression correlation and Gene Ontology annotation suggested that OsNF-Y genes were co-expressed with genes that participated in stress, accumulation of seed storage reserves, and plant development.
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+
* Co-expression analysis also revealed that OsNF-Y genes might interact with each other, suggesting that NF-γ subunits formed complexes that take part in transcriptional regulation.<ref name="ref1" />
            clade; Ehrhartoideae; Oryzeae; Oryza.
+
===Evolution===
|
+
* NF-γ is a heterotrimeric complex composed of three subunits: NF-γA (CBF-B/HAP2), NF-γB (CBF-A/HAP3), and NF-γC
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
+
(CBF-C/HAP5).  
AP = Chromosome 5:13727717..13729273|
+
* NF-γ complexes are CCAAT-specific transcription factors that bind to CCAAT sites in DNA to control the expression of target genes<ref name="ref1" /> .
CDS = 13727976..13728959|
+
You can also add sub-section(s) at will.
GCID = <gbrowseImage1>
+
==Labs working on this gene==
name=NC_008398:13727717..13729273
+
* College of Life Science and Technology, Huazhong Agricultural University, Wuhan, 430070, China
source=RiceChromosome05
+
* College of Plant Science and Technology, Huazhong Agricultural University, Wuhan, 430070, China
preset=GeneLocation
+
==References==
</gbrowseImage1>|
+
<references>
GSID = <gbrowseImage2>
+
* <ref name="ref1">
name=NC_008398:13727717..13729273
+
Yang, W., Lu, Z., Xiong, Y., & Yao, J. (2016). Genome-wide identification and co-expression network analysis of the OsNF-γ gene family in rice. The Crop Journal.
source=RiceChromosome05
+
</ref>
preset=GeneLocation
+
* <ref name="ref2">
</gbrowseImage2>|
+
Laloum T, De Mita S, Gamas P, Baudin M, Niebel A. CCAAT-box binding
CDNA = <cdnaseq>atggcgattccaacaaaggaggaggtggagcagaatgaggaggacaatacattttcaaggttgcaattgcttgcacaacaacggcatgccatggaggaattctggaggaggagccaggaacaaatcgaggcatctgcaggcaaccatgagcatatactaccaattgactgcgtgaagaatgtcattcgaccaaagaatgatgctatgatgctatctgctgacacaccaacttttgtgacaaaactttgtgagctcttcgtgcaggagctcaccctccgtgcatgggtatgtgccaactctcacaaccgtgacatcatattaggcacagacattgctgaggcaatcaccaccactgaatcctatcactttcttggtaatgtacttcgtagccacaaggcactaggaagtactgctcctgacatagatacttctgctaggaagcatattaagctagaccaaatgacctcactctaccatcctacccaagaaatgcaggcctcacgtttagctgggtatccaccccatgttcctatatatcctcctataggtcaaatgggaactcaacacaagctgtctccattcacttttatgatgcaaggagaatctcttctcaacatgaaaagagaaaaatccctagttaatgaagtgatggtatgcaccaacaagatgagcataaacaactttgatggagctactagtattggtggtggtagtagtagtgatgttgctattgttgtccagcaaggggaaactacacacccattctcatcccagaatgcatgtccttccctagaagataactatgttgttcccatgcctacgggacatgttcagagttttagccctcctactaatatcaatgtcaagaagctacatcaagaggagaaaaacatctattcacaagatgttgctgaagaggacatgtccaatgagtctttggagggaagccagaaggatgaggacctatttcttcatgagaaataa</cdnaseq>|
+
transcription factors in plants: Y so many? Trends Plant Sci. 2013
AA = <aaseq>MAIPTKEEVEQNEEDNTFSRLQLLAQQRHAMEEFWRRSQEQIEA                    SAGNHEHILPIDCVKNVIRPKNDAMMLSADTPTFVTKLCELFVQELTLRAWVCANSHN                    RDIILGTDIAEAITTTESYHFLGNVLRSHKALGSTAPDIDTSARKHIKLDQMTSLYHP                    TQEMQASRLAGYPPHVPIYPPIGQMGTQHKLSPFTFMMQGESLLNMKREKSLVNEVMV                    CTNKMSINNFDGATSIGGGSSSDVAIVVQQGETTHPFSSQNACPSLEDNYVVPMPTGH                    VQSFSPPTNINVKKLHQEEKNIYSQDVAEEDMSNESLEGSQKDEDLFLHEK</aaseq>|
+
Mar;18(3):157-66. doi: 10.1016/j.tplants.2012.07.004. Epub 2012 Aug 30. Review.
DNA = <dnaseqindica>260..1243#atcgaccacaccataaattggtcacctgcttcaacatcttgatataagaaaggttgtttattatatcattattatgtacttctactaattcttgagtgttagtgtaaattgtgttagtggctatacttccaacgagaagcaatgtagtttctattcaatttacatatttttactgggaagatgaaataagttgttgtttcaagcaagtacttaactgagttattgttcatgcattacttaaaaatgtaggagtaaagaaatggcgattccaacaaaggaggaggtggagcagaatgaggaggacaatacattttcaaggttgcaattgcttgcacaacaacggcatgccatggaggaattctggaggaggagccaggaacaaatcgaggcatctgcaggcaaccatgagcatatactaccaattgactgcgtgaagaatgtcattcgaccaaagaatgatgctatgatgctatctgctgacacaccaacttttgtgacaaaactttgtgagctcttcgtgcaggagctcaccctccgtgcatgggtatgtgccaactctcacaaccgtgacatcatattaggcacagacattgctgaggcaatcaccaccactgaatcctatcactttcttggtaatgtacttcgtagccacaaggcactaggaagtactgctcctgacatagatacttctgctaggaagcatattaagctagaccaaatgacctcactctaccatcctacccaagaaatgcaggcctcacgtttagctgggtatccaccccatgttcctatatatcctcctataggtcaaatgggaactcaacacaagctgtctccattcacttttatgatgcaaggagaatctcttctcaacatgaaaagagaaaaatccctagttaatgaagtgatggtatgcaccaacaagatgagcataaacaactttgatggagctactagtattggtggtggtagtagtagtgatgttgctattgttgtccagcaaggggaaactacacacccattctcatcccagaatgcatgtccttccctagaagataactatgttgttcccatgcctacgggacatgttcagagttttagccctcctactaatatcaatgtcaagaagctacatcaagaggagaaaaacatctattcacaagatgttgctgaagaggacatgtccaatgagtctttggagggaagccagaaggatgaggacctatttcttcatgagaaataatttcctccatttatttagaatatggaagaggaatacaacaatggcaacgatattcatgatggtaatttctccaaatcaagcaacagtatcaagaattactaaataaacaacaaatcaaaggaggatgcatcttagctatgtttatccaatgatgttgtatagtttaccttatactttactcaagattaataaaaaataatttgtgtgtgattccagtggtttaccttgtgtttccatctacctttgtatggacaataataaaaagattattgtttgtttgataattcaataataaaacattcataagttgtatc</dnaseqindica>|
+
Erratum in: Trends Plant Sci. 2013 Oct;18(10):594-5. PubMed PMID: 22939172.
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001061679.2 RefSeq:Os05g0304800]|
+
</ref>
}}
+
</references>
[[Category:Genes]]
+
==Structured Information==
[[Category:Japonica mRNA]]
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 5]]
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 5]]
 
[[Category:Chromosome 5]]
 

Latest revision as of 04:01, 31 March 2017

The rice Os05g0304800 was reported as OsNF-YC12 in 2016 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os05g0304800 <=> OsNF-YC12

Function

  • Nuclear factor γ (NF-γ) is a ubiquitous transcription factor that regulates important physiological and developmental processes.[1]
  • In plants, the roles of NF-γ were identified in regulation of embryogenesis, flowering time, chloroplast biogenesis, seed germination and stress tolerance.[1] [2]

Expression

  • Expression profile analysis covering the whole life cycle revealed that transcripts of OsNF-γ differentially accumulated in a tissue-specific preferential or constitutive manner.[1]
  • Analysis of expression correlation and Gene Ontology annotation suggested that OsNF-Y genes were co-expressed with genes that participated in stress, accumulation of seed storage reserves, and plant development.
  • Co-expression analysis also revealed that OsNF-Y genes might interact with each other, suggesting that NF-γ subunits formed complexes that take part in transcriptional regulation.[1]

Evolution

  • NF-γ is a heterotrimeric complex composed of three subunits: NF-γA (CBF-B/HAP2), NF-γB (CBF-A/HAP3), and NF-γC

(CBF-C/HAP5).

  • NF-γ complexes are CCAAT-specific transcription factors that bind to CCAAT sites in DNA to control the expression of target genes[1] .

You can also add sub-section(s) at will.

Labs working on this gene

  • College of Life Science and Technology, Huazhong Agricultural University, Wuhan, 430070, China
  • College of Plant Science and Technology, Huazhong Agricultural University, Wuhan, 430070, China

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 Yang, W., Lu, Z., Xiong, Y., & Yao, J. (2016). Genome-wide identification and co-expression network analysis of the OsNF-γ gene family in rice. The Crop Journal.
  2. Laloum T, De Mita S, Gamas P, Baudin M, Niebel A. CCAAT-box binding transcription factors in plants: Y so many? Trends Plant Sci. 2013 Mar;18(3):157-66. doi: 10.1016/j.tplants.2012.07.004. Epub 2012 Aug 30. Review. Erratum in: Trends Plant Sci. 2013 Oct;18(10):594-5. PubMed PMID: 22939172.

Structured Information