Difference between revisions of "Os01g0778400"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os01g0778400| Description = Conserved hypothetical protein| Version = NM_001185660.1 GI:297720454 GeneID:9268120| Length = 207 bp| Definition =...")
 
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
The rice '''''Os01g0778400''''' was reported as '''''OsAGP19''''' in 2010 <ref name="ref1" /> by researchers from China.
GeneName = Os01g0778400|
+
==Annotated Information==
Description = Conserved hypothetical protein|
+
===Gene Symbol===
Version = NM_001185660.1 GI:297720454 GeneID:9268120|
+
*'''''Os01g0778400''''' '''''<=>''''' '''''OsAGP19'''''
Length = 207 bp|
+
===Function===
Definition = Oryza sativa Japonica Group Os01g0778400, complete gene.|
+
* Arabinogalactan proteins is an umbrella term applied to a highly diverse class of cell surface glycoproteins, many of which contain glycosylphosphatidylinositol lipid anchors.<ref name="ref1" /> <ref name="ref2" /> 
Source = Oryza sativa Japonica Group
+
* Arabinogalactan proteins (AGPs) comprise a family of hydroxyproline-rich glycoproteins that are implicated in plant growth and development.<ref name="ref1" /> <ref name="ref2" /> 
 +
* Arabinogalactan proteins might be soluble signals, or might act as modulators and coreceptors of apoplastic morphogens; their amphiphilic molecular nature makes them prime candidates of mediators between the cell wall, the plasma membrane, and the cytoplasm.<ref name="ref1" /> <ref name="ref2" /> 
 +
===Expression===
 +
* The RT-qPCR analysis reveal that several rice AGP-encoding genes are predominantly expressed in anthers and display differential expression patterns in response to abscisic acid, gibberellic acid, and abiotic stresses.<ref name="ref1" />
 +
===Evolution===
 +
* Proteoglycans or glycoproteins are basal components of the cell wall implicated in various processes of plant growth and development throughout the plant kingdom. A large number of these proteins are rich in proline (Pro) or hydroxyproline (Hyp) and are named Pro-rich/Hyp-rich glycoproteins (P/HRGPs). <ref name="ref1" />
 +
* The P/HRGPs share common features that consist of regions containing Hyp residues, which are called ‘glycomodules’ and in which most Hyp residues are usually glycosylated by a large branched arabinogalactan (AG) polysaccharide or by small non-branched arabinooligosaccharides (arabinosides).<ref name="ref1" />
 +
You can also add sub-section(s) at will.
 +
==Labs working on this gene==
 +
* Key Laboratory of the Ministry of Education for Plant Developmental Biology, College of Life Sciences, Wuhan University, Wuhan 430072, PR China
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Ma H, Zhao J. Genome-wide identification, classification, and expression
 +
analysis of the arabinogalactan protein gene family in rice (Oryza sativa L.). J
 +
Exp Bot. 2010 Jun;61(10):2647-68. doi: 10.1093/jxb/erq104. Epub 2010 Apr 27.
 +
PubMed PMID: 20423940; PubMed Central PMCID: PMC2882264.
 +
</ref>
 +
* <ref name="ref2">
 +
Seifert GJ, Roberts K. The biology of arabinogalactan proteins. Annu Rev Plant
 +
Biol. 2007;58:137-61. Review. PubMed PMID: 17201686.
 +
</ref>
 +
</references>
  
  ORGANISM  Oryza sativa Japonica Group
+
==Structured Information==
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:34702490..34702696|
 
CDS = 34702490..34702696|
 
GCID = <gbrowseImage1>
 
name=NC_008394:34702490..34702696
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:34702490..34702696
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcggggcagctgaagtccaagatcgtcgccgtggcggtggccgccgtggtcgtcgtcgcctcgtcgctggtcggcacggcctccgcggccgatgcgcccgccccggcgcccacgtcgggcgccaccgccaccgccgccgcagcgccagccttcgccgccgtgtcggtcgccgccgcggctttgggaggttacctattctgttag</cdnaseq>|
 
AA = <aaseq>MAGQLKSKIVAVAVAAVVVVASSLVGTASAADAPAPAPTSGATA                    TAAAAPAFAAVSVAAAALGGYLFC</aaseq>|
 
DNA = <dnaseqindica>1..207#atggcggggcagctgaagtccaagatcgtcgccgtggcggtggccgccgtggtcgtcgtcgcctcgtcgctggtcggcacggcctccgcggccgatgcgcccgccccggcgcccacgtcgggcgccaccgccaccgccgccgcagcgccagccttcgccgccgtgtcggtcgccgccgcggctttgggaggttacctattctgttag</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001185660.1 RefSeq:Os01g0778400]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 09:24, 31 March 2017

The rice Os01g0778400 was reported as OsAGP19 in 2010 [1] by researchers from China.

Annotated Information

Gene Symbol

  • Os01g0778400 <=> OsAGP19

Function

  • Arabinogalactan proteins is an umbrella term applied to a highly diverse class of cell surface glycoproteins, many of which contain glycosylphosphatidylinositol lipid anchors.[1] [2]
  • Arabinogalactan proteins (AGPs) comprise a family of hydroxyproline-rich glycoproteins that are implicated in plant growth and development.[1] [2]
  • Arabinogalactan proteins might be soluble signals, or might act as modulators and coreceptors of apoplastic morphogens; their amphiphilic molecular nature makes them prime candidates of mediators between the cell wall, the plasma membrane, and the cytoplasm.[1] [2]

Expression

  • The RT-qPCR analysis reveal that several rice AGP-encoding genes are predominantly expressed in anthers and display differential expression patterns in response to abscisic acid, gibberellic acid, and abiotic stresses.[1]

Evolution

  • Proteoglycans or glycoproteins are basal components of the cell wall implicated in various processes of plant growth and development throughout the plant kingdom. A large number of these proteins are rich in proline (Pro) or hydroxyproline (Hyp) and are named Pro-rich/Hyp-rich glycoproteins (P/HRGPs). [1]
  • The P/HRGPs share common features that consist of regions containing Hyp residues, which are called ‘glycomodules’ and in which most Hyp residues are usually glycosylated by a large branched arabinogalactan (AG) polysaccharide or by small non-branched arabinooligosaccharides (arabinosides).[1]

You can also add sub-section(s) at will.

Labs working on this gene

  • Key Laboratory of the Ministry of Education for Plant Developmental Biology, College of Life Sciences, Wuhan University, Wuhan 430072, PR China

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Ma H, Zhao J. Genome-wide identification, classification, and expression analysis of the arabinogalactan protein gene family in rice (Oryza sativa L.). J Exp Bot. 2010 Jun;61(10):2647-68. doi: 10.1093/jxb/erq104. Epub 2010 Apr 27. PubMed PMID: 20423940; PubMed Central PMCID: PMC2882264.
  2. 2.0 2.1 2.2 Seifert GJ, Roberts K. The biology of arabinogalactan proteins. Annu Rev Plant Biol. 2007;58:137-61. Review. PubMed PMID: 17201686.

Structured Information