|
|
| (One intermediate revision by one other user not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | The rice '''''Os03g0745000''''' was reported as '''''OsHsf-11''''' in 2008 <ref name="ref1" /> by researchers from China. |
| − | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | ===Gene Symbol=== |
| | + | *'''''Os03g0745000''''' '''''<=>''''' '''''OsHsf-11''''' |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | * The heat shock transcription factors (HSFs) are the major heat shock factors regulating the heat stress response. |
| − | | + | * The heat shock transcription factors (HSFs) participate in regulating the expression of heat shock proteins (HSPs), which are critical in the protection against stress damage and many other important biological processes. |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | * Expression data analysis indicates that HSF proteins are widely expressed in plants. |
| − | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Please input evolution information here.
| + | * Phylogenetic analyses resulted in the identification of three major clusters of orthologous genes that contain members belonging to both species, which must have been represented in their common ancestor before the taxonomic splitting of the angiosperms. |
| − | | |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| − |
| |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | * School of Life Sciences, Shanghai University, Shanghai 200444, China |
| − | | + | * College of Light Industry and Food Sciences, South China University of Technology, Guangzhou 510640, China |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| − | | + | * <ref name="ref1"> |
| | + | Guo J, Wu J, Ji Q, Wang C, Luo L, Yuan Y, Wang Y, Wang J. Genome-wide analysis |
| | + | of heat shock transcription factor families in rice and Arabidopsis. J Genet |
| | + | Genomics. 2008 Feb;35(2):105-18. doi: 10.1016/S1673-8527(08)60016-8. PubMed PMID: |
| | + | 18407058. |
| | + | </ref> |
| | + | </references> |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 3]] |
| − | GeneName = Os03g0745000|
| |
| − | Description = Winged helix repressor DNA-binding domain containing protein|
| |
| − | Version = NM_001057776.2 GI:297601672 GeneID:4334080|
| |
| − | Length = 2455 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os03g0745000, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
| |
| − | AP = Chromosome 3:31367863..31370317|
| |
| − | CDS = 31368420..31369214,31369296..31369631|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008396:31367863..31370317
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008396:31367863..31370317
| |
| − | source=RiceChromosome03
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgaatccattgcgcgtcatcgtgaaagaggaggagctcgacttcgccgccgcggcggcggcggcggcggcgggtgagggctcgccgtcgtcgtgggcggtcggcgtgatggacctgcctcgtccaatggagggcctcggcgaggccgggccgccgccgttcttgtgcaagacgtacgaggtcgtggacgaccccggcacggacaccgtcatctcgtgggggttcgccggcaacagcttcgtcgtctgggacgccaatgcgttcgccgccgtgctcctcccgcgctacttcaagcacagcaacttctccagcttcgtccgccagctcaacacctacgggttcaggaaggtcgatccggatagatgggagttcgcgaacgaggggttcttgcgggggaagaaggagctcctgaagacgatcaagcgacgccggccgccgccgtcgagccccccgtcgtcttcgtcgtcgtcgtcgtcgtcgcagcaccagcagcagccggcggcggcgtgcctggaggtggggcagttcgggcgcgacggcgtggtgaaccggctgcagcgcgacaagagcgtcctgatcgcggaggtggtgaagctgcggcaggagcagcagacgacgcgcgcgcagatgcaggcgatggaggagcgcatctcggcggcggagcagaagcagcagcagatgacggtgttcctggcgcgcgccatgaagaacccgggcttcctccagatgctcgtcgaccggcaggccggccagcacggcgcccggaacagggtgctcgaggacgccctctccaagaagcgccgccgccccatcgagtacctcctcacccgcaacggcgagacctgcgccgccggcgagtcggcagctatgctggcggcggacggcgtggcggagccggacggcgacaccaccccgcgcggcgacggcggcggcggcggcggcggcgacaccgagagcttctggatgcagctgctcagcctcggcctggaggagaagcagcgagaggacggcgtcgccggcggcgtccaggagagtaacagcggcggcgctgacgtggacaacgacgaggaggatgacgacgatgacgtggacgtgctcgtgcagagcatatatcacctcagccccaagtga</cdnaseq>|
| |
| − | AA = <aaseq>MNPLRVIVKEEELDFAAAAAAAAAGEGSPSSWAVGVMDLPRPME GLGEAGPPPFLCKTYEVVDDPGTDTVISWGFAGNSFVVWDANAFAAVLLPRYFKHSNF SSFVRQLNTYGFRKVDPDRWEFANEGFLRGKKELLKTIKRRRPPPSSPPSSSSSSSSS QHQQQPAAACLEVGQFGRDGVVNRLQRDKSVLIAEVVKLRQEQQTTRAQMQAMEERIS AAEQKQQQMTVFLARAMKNPGFLQMLVDRQAGQHGARNRVLEDALSKKRRRPIEYLLT RNGETCAAGESAAMLAADGVAEPDGDTTPRGDGGGGGGGDTESFWMQLLSLGLEEKQR EDGVAGGVQESNSGGADVDNDEEDDDDDVDVLVQSIYHLSPK</aaseq>|
| |
| − | DNA = <dnaseqindica>1104..1898#687..1022#ggtttcgacgagctccatcatccaagtacgaaggggataaagggactcatcactccacccagctggagagaaaaaaaatctcagctgtacttgctcgtgttctttcctctcccttttcttctccgccatcattttctctgtactttggggtgtacttcatccttctgtattttcggttctttttgctctgatttgtcatcttttttttgcgagcgagctcgttcgctcgccaacgaacactcctgctgtagctgttcttggcgttaatgaaagccctgcattctcgcatttgcaatcgccatttattcagctgtgatctttgtagagtgttgtgttgattaagaatcgcatgatttgggttccattggtttgtttttgcaagagtttttgtgtttttctctgatcccctttcagctgattgaatgatcatcttctcccctaattctccatctgtctttggtggtgattgatcacttaaactctacacaatttgatattttttgcaaacttttcagaggcaagatcgttccagattgaattcgttcggtggagggcgatatattttttttcggcaaggatcgccattctcaccggtcgttcaaattcttctcctgcgttaagtggctgtgtgtgctctgttcgtcatcttcctctgctactcaattgcattggttggttggttagacatgaatccattgcgcgtcatcgtgaaagaggaggagctcgacttcgccgccgcggcggcggcggcggcggcgggtgagggctcgccgtcgtcgtgggcggtcggcgtgatggacctgcctcgtccaatggagggcctcggcgaggccgggccgccgccgttcttgtgcaagacgtacgaggtcgtggacgaccccggcacggacaccgtcatctcgtgggggttcgccggcaacagcttcgtcgtctgggacgccaatgcgttcgccgccgtgctcctcccgcgctacttcaagcacagcaacttctccagcttcgtccgccagctcaacacctacgtaagtccatcaatggcggaatgcgatgcgcggttcgtgttttggcgtgatcaatggcggggttcttgattttcttttcaggggttcaggaaggtcgatccggatagatgggagttcgcgaacgaggggttcttgcgggggaagaaggagctcctgaagacgatcaagcgacgccggccgccgccgtcgagccccccgtcgtcttcgtcgtcgtcgtcgtcgtcgcagcaccagcagcagccggcggcggcgtgcctggaggtggggcagttcgggcgcgacggcgtggtgaaccggctgcagcgcgacaagagcgtcctgatcgcggaggtggtgaagctgcggcaggagcagcagacgacgcgcgcgcagatgcaggcgatggaggagcgcatctcggcggcggagcagaagcagcagcagatgacggtgttcctggcgcgcgccatgaagaacccgggcttcctccagatgctcgtcgaccggcaggccggccagcacggcgcccggaacagggtgctcgaggacgccctctccaagaagcgccgccgccccatcgagtacctcctcacccgcaacggcgagacctgcgccgccggcgagtcggcagctatgctggcggcggacggcgtggcggagccggacggcgacaccaccccgcgcggcgacggcggcggcggcggcggcggcgacaccgagagcttctggatgcagctgctcagcctcggcctggaggagaagcagcgagaggacggcgtcgccggcggcgtccaggagagtaacagcggcggcgctgacgtggacaacgacgaggaggatgacgacgatgacgtggacgtgctcgtgcagagcatatatcacctcagccccaagtgaaaggtcgagaaggttccacggcgaaaacgaagggtacgtttcgtttcgtagggtgacgtaatcgcaacagtagcgagtagtaggaatgtaggggtagcactgcacttgtctttctttccatttttttatagtttcggacatcttgtcgccgccctgcaagttgccaaaaaaagcagccaagccccactgccacaggcgacggaaggttcaagaagtcgagaagcttctcccgcgggggaagcttctagaggtgtccagtaagacagcacagtagctgcgggtgttcaagaagctgggaagcttctagatgtcctctaggacggtggcttcgaatgttcttcttctggaatttgcacctagtatcagctaattatgtgcgctgtattttgcccatgctactgccatatgcaactggtgcctcttatcccccaacagctactgctgcccttttaaaatttgaaagttacggagtaatttcagctgatttttaagtttcttcattagtagtttactttctgtattggttgtcaaatcttaaataaagttctacttataaa</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057776.2 RefSeq:Os03g0745000]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 3]]
| |
| − | [[Category:Chromosome 3]]
| |
